Recombinant Rat Platelet-activating factor receptor (Ptafr)

Code: CSB-CF018946RA
Size:
20μg
20μg100μg
US$5046
Quantity:
Express system: in vitro E.coli expression system
Species: Rattus norvegicus (Rat)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
Ptafr
Uniprot NO.
Alternative Names
Ptafr; Platelet-activating factor receptor; PAF-R; PAFr
Species
Rattus norvegicus (Rat)
Source
in vitro E.coli expression system
Expression Region
1-341
Target Protein Sequence
MEQNGSFRVDSEFRYTLFPIVYSVIFVLGVVANGYVLWVFATLYPSKKLNEIKIFMVNLT VADLLFLMTLPLWIVYYSNEGDWIVHKFLCNLAGCLFFINTYCSVAFLGVITYNRYQAVA YPIKTAQATTRKRGITLSLVIWISIAATASYFLATDSTNVVPKKDGSGNITRCFEHYEPY SVPILVVHIFITSCFFLVFFLIFYCNMVIIHTLLTRPVRQQRKPEVKRRALWMVCTVLAV FVICFVPHHVVQLPWTLAELGYQTNFHQAINDAHQITLCLLSTNCVLDPVIYCFLTKKFR KHLSEKFYSMRSSRKCSRATSDTCTEVMMPANQTPVLPLKN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Receptor for platelet activating factor, a chemotactic phospholipid mediator that possesses potent inflammatory, smooth-muscle contractile and hypotensive activity. Seems to mediate its action via a G protein that activates a phosphatidylinositol-calcium second messenger system.
Gene References into Functions
  1. In hypoxic tissue, PAFR protein expression is up-regulated, but is reduced in the bilobalide treated tissue. PMID:21391918
  2. These data show the histological localization of PAF synthases and its receptor in the spinal cord following peripheral nerve injury. PMID:22296727
  3. PAF inhibition interkinetic nuclear migration (IKNM) in retinal proliferating progenitors depended on the PAF receptor, Erk and p38 pathways and Chk1 PMID:21298035
  4. differential activation of both G(i) and G(q) by PAFR likely mediate specific as well as redundant signaling pathways PMID:16920964
  5. PAF receptor gene expression may be subject to down-regulation in the perifocal regions of cerebral infarction after cerebral ischemia-reperfusion. PMID:17268849
  6. Platelet activating factor receptor (PAF-R) plays an important role in occurrence and development of severe acute pancreatitis. BN52021 exerts biological effects through competitively inhibiting the binding of increased both PAF and PAF-R expression. PMID:17589953
  7. Cirrhosis sensitizes hepatic stellate cells to PAF by elevating its receptor level PMID:18186558

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Present in almost all organs including spleen, small intestine, kidney, lung, liver and brain.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products