Home
Product
Protein
Transmembrane Proteins
Recombinant Rat Platelet-activating factor receptor (Ptafr)

Recombinant Rat Platelet-activating factor receptor (Ptafr)

Code: CSB-CF018946RA

Rate （N/A）
Review （0）

Size:

20μg100μg

US$5046

Quantity:

Express system: in vitro E.coli expression system

Species: Rattus norvegicus (Rat)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

Ptafr

Uniprot NO.

P46002

Alternative Names

Ptafr; Platelet-activating factor receptor; PAF-R; PAFr

Species

Rattus norvegicus (Rat)

Source

in vitro E.coli expression system

Expression Region

1-341

Target Protein Sequence

MEQNGSFRVDSEFRYTLFPIVYSVIFVLGVVANGYVLWVFATLYPSKKLNEIKIFMVNLT VADLLFLMTLPLWIVYYSNEGDWIVHKFLCNLAGCLFFINTYCSVAFLGVITYNRYQAVA YPIKTAQATTRKRGITLSLVIWISIAATASYFLATDSTNVVPKKDGSGNITRCFEHYEPY SVPILVVHIFITSCFFLVFFLIFYCNMVIIHTLLTRPVRQQRKPEVKRRALWMVCTVLAV FVICFVPHHVVQLPWTLAELGYQTNFHQAINDAHQITLCLLSTNCVLDPVIYCFLTKKFR KHLSEKFYSMRSSRKCSRATSDTCTEVMMPANQTPVLPLKN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Receptor for platelet activating factor, a chemotactic phospholipid mediator that possesses potent inflammatory, smooth-muscle contractile and hypotensive activity. Seems to mediate its action via a G protein that activates a phosphatidylinositol-calcium second messenger system.

Gene References into Functions

In hypoxic tissue, PAFR protein expression is up-regulated, but is reduced in the bilobalide treated tissue. PMID:21391918
These data show the histological localization of PAF synthases and its receptor in the spinal cord following peripheral nerve injury. PMID:22296727
PAF inhibition interkinetic nuclear migration (IKNM) in retinal proliferating progenitors depended on the PAF receptor, Erk and p38 pathways and Chk1 PMID:21298035
differential activation of both G(i) and G(q) by PAFR likely mediate specific as well as redundant signaling pathways PMID:16920964
PAF receptor gene expression may be subject to down-regulation in the perifocal regions of cerebral infarction after cerebral ischemia-reperfusion. PMID:17268849
Platelet activating factor receptor (PAF-R) plays an important role in occurrence and development of severe acute pancreatitis. BN52021 exerts biological effects through competitively inhibiting the binding of increased both PAF and PAF-R expression. PMID:17589953
Cirrhosis sensitizes hepatic stellate cells to PAF by elevating its receptor level PMID:18186558