Adcyap1r1; Pituitary adenylate cyclase-activating polypeptide type I receptor; PACAP type I receptor; PACAP-R-1; PACAP-R1
Species
Rattus norvegicus (Rat)
Source
in vitro E.coli expression system
Expression Region
20-523
Target Protein Sequence
MHSDCIFKKEQAMCLERIQRANDLMGLNESSPGCPGMWDNITCWKPAQVGEMVLVSCPEV FRIFNPDQVWMTETIGDSGFADSNSLEITDMGVVGRNCTEDGWSEPFPHYFDACGFDDYE PESGDQDYYYLSVKALYTVGYSTSLATLTTAMVILCRFRKLHCTRNFIHMNLFVSFMLRA ISVFIKDWILYAEQDSSHCFVSTVECKAVMVFFHYCVVSNYFWLFIEGLYLFTLLVETFF PERRYFYWYTIIGWGTPTVCVTVWAVLRLYFDDAGCWDMNDSTALWWVIKGPVVGSIMVN FVLFIGIIIILVQKLQSPDMGGNESSIYLTNLRLRVPKKTREDPLPVPSDQHSPPFLSCV QKCYCKPQRAQQHSCKMSELSTITLRLARSTLLLIPLFGIHYTVFAFSPENVSKRERLVF ELGLGSFQGFVVAVLYCFLNGEVQAEIKRKWRSWKVNRYFTMDFKHRHPSLASSGVNGGT QLSILSKSSSQLRMSSLPADNLAT
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
This is a receptor for PACAP-27 and PACAP-38. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. May regulate the release of adrenocorticotropin, luteinizing hormone, growth hormone, prolactin, epinephrine, and catecholamine. May play a role in spermatogenesis and sperm motility. Causes smooth muscle relaxation and secretion in the gastrointestinal tract.
Gene References into Functions
This study demonstrated that the hypothalamic PAC1 mRNA expression level fell after 24 h fasting in male rats, but no such changes were observed in the females.PMID:27181029
Compared to the rats in the control group, the rats in the HF group had the expression levels of 12 genes with significant changes, Agrp, Ghrl, and Nr3c1, Apoa4, Cntf, Ghr, IL-1beta, Ins1, Lepr,Sort, Adcyap1r1 and Adrb1.PMID:22715380
PACAP-38 cause release of CGRP from trigeminal nucleus caudalis but not from trigeminal ganglia but not via activation of PAC1.PMID:24508136
PAC1-R-immunoreactive structures appearing from postnatal day 5 (P5) to P10 in the rat retina, are described..PMID:24352804
Middle meningeal arteries expressed multiple variants of the PAC1 receptor. The expression of PAC1 receptors and the high potency of PACAP to induce MMA vasodilation are consistent with their potential roles in the etiology of migraine.PMID:22766684
PACAP causes PAC1/VPAC2 receptor mediated hypertension and sympathoexcitation in normal and hypertensive rats.PMID:22886412
PAC1hop, null and hip receptors mediate differential signaling through cyclic AMP and calcium leading to splice variant-specific gene induction in neural cells.PMID:21693142
If small molecule PAC-1 receptor antagonists could be identified, they might produce broad-spectrum analgesia in both inflammatory and neuropathic pain states.PMID:18337184
inhibitory effect of pituitary adenylate cyclase-activating polypeptide on food intake may be mediated, at least in part, through modulation of neuropeptide Y neurotransmission.PMID:16888209
the hop cassette of the PAC1 receptor has a role in coupling to Ca2+ elevation required for PACAP-evoked neurosecretion.PMID:17213203
pituitary adenylate-cyclase activating polypeptide and its type 1 receptor, functions as a stimulator of prolactin alone or with thyrotropin releasing hormone in prolactin producing cellsPMID:21539889
Expression of pituitary adenylate cyclase-activating peptide 1 receptor (PAC1) is significantly increased in the brain of aged rats.PMID:20599818
In HEK cells stably overexpressing functional rat PAC1 receptors, PACAP-27 and PACAP-38 strongly stimulated alpha-secretase cleavage of APP.PMID:16401644
PAC1-R immunoreactivity was co-localized with afferent dendritic neuronal marker GluR2/3 in nerve fibers passing beneath and lateral to the inner hair cell and in fibers at supranuclear and basal sites on outer hair cells.PMID:16876955
The specificity of PAC1 receptor participation in pituitary adenylate cyclase-activating polypeptide-facilitated sex behavior was demonstarted.(PAC1 receptor)PMID:15976009
PAC1HOP1 receptor activation coordinates multiple neurotrophic signaling pathways, which involves Akt activation through phosphatidylinositol 3-kinase gamma and vesicle endocytosis for neuronal survivalPMID:20093365
no age-related differences were observed for pituitary adenylate cyclase activating peptide 1 receptor mRNA in the suprachiasmatic nucleus of young or aged male ratsPMID:15344914
PAC1(3a) was originally discovered in testes as another potential regulator in rat astrocytesPMID:16888214
PAC1-R-positive cells were also seen in the thymic medulla of the rhesus monkeyPMID:16888229
Novel stable PACAP analogs with potent activity towrds the PAC1 receptor are freported.PMID:18353507