Recombinant Rat Pituitary adenylate cyclase-activating polypeptide type IA receptor (Adcyap1r1)

Code: CSB-CF001347RA
Size:
20μg
20μg100μg
US$6266
Quantity:
Express system: in vitro E.coli expression system
Species: Rattus norvegicus (Rat)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
Adcyap1r1
Uniprot NO.
Alternative Names
Adcyap1r1; Pituitary adenylate cyclase-activating polypeptide type I receptor; PACAP type I receptor; PACAP-R-1; PACAP-R1
Species
Rattus norvegicus (Rat)
Source
in vitro E.coli expression system
Expression Region
20-523
Target Protein Sequence
MHSDCIFKKEQAMCLERIQRANDLMGLNESSPGCPGMWDNITCWKPAQVGEMVLVSCPEV FRIFNPDQVWMTETIGDSGFADSNSLEITDMGVVGRNCTEDGWSEPFPHYFDACGFDDYE PESGDQDYYYLSVKALYTVGYSTSLATLTTAMVILCRFRKLHCTRNFIHMNLFVSFMLRA ISVFIKDWILYAEQDSSHCFVSTVECKAVMVFFHYCVVSNYFWLFIEGLYLFTLLVETFF PERRYFYWYTIIGWGTPTVCVTVWAVLRLYFDDAGCWDMNDSTALWWVIKGPVVGSIMVN FVLFIGIIIILVQKLQSPDMGGNESSIYLTNLRLRVPKKTREDPLPVPSDQHSPPFLSCV QKCYCKPQRAQQHSCKMSELSTITLRLARSTLLLIPLFGIHYTVFAFSPENVSKRERLVF ELGLGSFQGFVVAVLYCFLNGEVQAEIKRKWRSWKVNRYFTMDFKHRHPSLASSGVNGGT QLSILSKSSSQLRMSSLPADNLAT
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
This is a receptor for PACAP-27 and PACAP-38. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. May regulate the release of adrenocorticotropin, luteinizing hormone, growth hormone, prolactin, epinephrine, and catecholamine. May play a role in spermatogenesis and sperm motility. Causes smooth muscle relaxation and secretion in the gastrointestinal tract.
Gene References into Functions
  1. This study demonstrated that the hypothalamic PAC1 mRNA expression level fell after 24 h fasting in male rats, but no such changes were observed in the females. PMID:27181029
  2. Compared to the rats in the control group, the rats in the HF group had the expression levels of 12 genes with significant changes, Agrp, Ghrl, and Nr3c1, Apoa4, Cntf, Ghr, IL-1beta, Ins1, Lepr,Sort, Adcyap1r1 and Adrb1. PMID:22715380
  3. PACAP-38 cause release of CGRP from trigeminal nucleus caudalis but not from trigeminal ganglia but not via activation of PAC1. PMID:24508136
  4. PAC1-R-immunoreactive structures appearing from postnatal day 5 (P5) to P10 in the rat retina, are described.. PMID:24352804
  5. Middle meningeal arteries expressed multiple variants of the PAC1 receptor. The expression of PAC1 receptors and the high potency of PACAP to induce MMA vasodilation are consistent with their potential roles in the etiology of migraine. PMID:22766684
  6. PACAP causes PAC1/VPAC2 receptor mediated hypertension and sympathoexcitation in normal and hypertensive rats. PMID:22886412
  7. PAC1hop, null and hip receptors mediate differential signaling through cyclic AMP and calcium leading to splice variant-specific gene induction in neural cells. PMID:21693142
  8. If small molecule PAC-1 receptor antagonists could be identified, they might produce broad-spectrum analgesia in both inflammatory and neuropathic pain states. PMID:18337184
  9. inhibitory effect of pituitary adenylate cyclase-activating polypeptide on food intake may be mediated, at least in part, through modulation of neuropeptide Y neurotransmission. PMID:16888209
  10. the hop cassette of the PAC1 receptor has a role in coupling to Ca2+ elevation required for PACAP-evoked neurosecretion. PMID:17213203
  11. pituitary adenylate-cyclase activating polypeptide and its type 1 receptor, functions as a stimulator of prolactin alone or with thyrotropin releasing hormone in prolactin producing cells PMID:21539889
  12. Expression of pituitary adenylate cyclase-activating peptide 1 receptor (PAC1) is significantly increased in the brain of aged rats. PMID:20599818
  13. In HEK cells stably overexpressing functional rat PAC1 receptors, PACAP-27 and PACAP-38 strongly stimulated alpha-secretase cleavage of APP. PMID:16401644
  14. PAC1-R immunoreactivity was co-localized with afferent dendritic neuronal marker GluR2/3 in nerve fibers passing beneath and lateral to the inner hair cell and in fibers at supranuclear and basal sites on outer hair cells. PMID:16876955
  15. The specificity of PAC1 receptor participation in pituitary adenylate cyclase-activating polypeptide-facilitated sex behavior was demonstarted.(PAC1 receptor) PMID:15976009
  16. PAC1HOP1 receptor activation coordinates multiple neurotrophic signaling pathways, which involves Akt activation through phosphatidylinositol 3-kinase gamma and vesicle endocytosis for neuronal survival PMID:20093365
  17. no age-related differences were observed for pituitary adenylate cyclase activating peptide 1 receptor mRNA in the suprachiasmatic nucleus of young or aged male rats PMID:15344914
  18. PAC1(3a) was originally discovered in testes as another potential regulator in rat astrocytes PMID:16888214
  19. PAC1-R-positive cells were also seen in the thymic medulla of the rhesus monkey PMID:16888229
  20. Novel stable PACAP analogs with potent activity towrds the PAC1 receptor are freported. PMID:18353507

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 2 family
Tissue Specificity
Hypothalamus, anterior pituitary, adrenal medulla, testicular germ cells.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products