MAIAHLATEYVFSDFLLKEPTEPKFKGLRLELAVDKMVTCIAVGLPLLLISLAFAQEISI GTQISCFSPSSFSWRQAAFVDSYCWAAVQQKNSLQSESGNLPLWLHKFFPYILLLFAILL YLPALFWRFAAAPHLCSDLKFIMEELDKVYNRAIKAAKSARDLDLRDGPGPPGVTENVGQ SLWEISESHFKYPIVEQYLKTKKNSSHLIMKYISCRLVTFAVVLLACIYLSYYFSLSSLS DEFLCSIKSGVLRNDSTIPDSFQCKLIAVGIFQLLSLINLLVYALLVPVVIYTLFVPFRQ KTDVLKVYEILPTFDVLHFKSEGYNDLSLYNLFLEENISELKSYKCLKVLENIKSNGQGI DPMLLLTNLGMIKMDVIDGKVPMSLQTKGEDQGSQRMDFKDLDLSSETAANNGEKNSRQR LLNSSC
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Structural component of the gap junctions and the hemichannels. May play a role as a Ca(2+)-leak channel to regulate ER Ca(2+) homeostasis.
Gene References into Functions
the upregulation of Pannexin1 expression may be involved in apoptosis and degeneration of neurons in the rat brain following ICH, and may contribute to subsequent cognitive dysfunction.PMID:29484398
panx1 contributes to distension- or LPS-evoked ATP release into the lumen of the bladder and that luminal release can modulate voiding function.PMID:25630792
Px1 channels releasing ATP have any role in the constrictor actions of alpha1-adrenoceptor activationPMID:25637780
These findings indicate that Panx1 participates in urothelial mechanotransduction and signaling by providing a direct pathway for mechanically-induced ATP release and by functionally interacting with P2X7RsPMID:25170954
It was shown that angiotensin signaling in type II cells activates an inward current carried by Panx1 channels.PMID:25172944
ETV4 and cAMP response elements play a role in the transcriptional regulation of Panx1 in the epididymis.PMID:25376229
Panx1 up-regulation contributes to pain hypersensitivity induced by nerve injury.PMID:25925949
Study found that astrocytes released ATP in response to mechanical strain, with pannexin 1 the predominant efflux pathwayPMID:24839011
Pannexin-1 hemichannels regulate urothelial overactivity in the bladder via activation of uracil nucleotidetide (UDP)-sensitive P2Y6 receptors.PMID:24269631
These results suggest that panx1 contributes to pathophysiological ATP release in lipoapoptosis induced by saturated FFA; panx1 may play a role in hepatic inflammation by mediating an increase in extracellular ATP concentration in lipotoxic liver injury.PMID:22972801
Activation of NMDA receptors during anoxia/ischemia recruits Src family kinases to open Panx1 channels, leading to sustained neuronal depolarizations.PMID:22956847
pannexin 1 is expressed in smooth muscle but not in endothelium of middle cerebral arteries.PMID:22301733
The results suggest that Panx1c and Panx1d may serve as dominant-negative effectors to modulate the functions of Panx1a through formation of heteromeric channels.PMID:21907716
ATP, released through Px1 hemichannels, activates purinergic P2X7 receptors, resulting in the closure of Px1 hemichannels during ischemia.PMID:21185900
Overexpression of pannexins 1 and 2 in pituitary cells enhanced the release of ATP.PMID:21467198
indicate that the oligomerization and trafficking of Panx1 are regulated by the C-terminal domain, whereas internalization of long lived Panx1 channels occurs in a manner that is distinct from classical endocytic pathwaysPMID:21659516
In the testis, Panx1 localized to the basal compartment of the seminiferous epithelium, while Panx3 was expressed in Leydig cells. In the ED, both Panxs were expressed in the apical region of ciliated cells.PMID:21337450
Pannexin1 and Pannexin2 channels show quaternary similarities to connexons and different oligomerization numbers from each otherPMID:20516070
Panx1 and Panx3 are coexpressed in the mammalian epidermis, and the regulation of Panx1 plays a key role in keratinocyte differentiation.PMID:20332104
New insight into relationship of decreased glucose to increased seizure threshold is established through neuronal adenosine triphosphate (ATP) release via pannexin hemichannels and hippocampal adenosine A1 receptors coupled to potassium ATP channels.PMID:20237259
although Panx1 and Panx3 share a common endoplasmic reticulum to Golgi secretory pathway to Cx43, their ultimate cell surface residency appears to be independent of cell contacts and the need for intact microtubulesPMID:20086016
the different expression patterns of pannexin 1 (Panx1) and pannexin 2 (Panx2) in the brain indicate that pannexins form cell type-specific gap junctions with distinct properties that may subserve different functions.PMID:14597722
Panx1 and Panx2 are abundantly expressed in the retina, and may therefore contribute to the electrical and metabolic coupling, or to signaling between retinal neuronsPMID:16616526
Has kinetics and dynamics that make it unique to serve distinct functions separate from connexin-based channels.PMID:18649184
Results show that pannexins 1, 2, and 3 are abundantly expressed in the mouse and rat cochlea and demonstrate distinct cellular distributions.PMID:19009624
study concludes that Px1 hemichannel opening is triggered by NMDAR stimulation and can contribute to epileptiform seizure activityPMID:19056988
in contrast to macrophages and monocytes in which low intracellular K(+) has been suggested to trigger inflammasome activation, in neural cells, high extracellular K(+) activates caspase-1 probably through pannexin 1PMID:19416975
Expressed in the eye, thyroid, prostate, kidney and liver. Abundantly expressed in the CNS, including hippocampus, olfactory bulb, cortex, cerebellum and white matter.