MTEVPWSAVPNGTDAAFLAGLGSLWGNSTIASTAAVSSSFRCALIKTGFQFYYLPAVYIL VFIIGFLGNSVAIWMFVFHMKPWSGISVYMFNLALADFLYVLTLPALIFYYFNKTDWIFG DVMCKLQRFIFHVNLYGSILFLTCISAHRYSGVVYPLKSLGRLKKKNAIYVSVLVWLIVV VAISPILFYSGTGIRKNKTVTCYDSTSDEYLRSYFIYSMCTTVAMFCIPLVLILGCYGLI VRALIYKDLDNSPLRRKSIYLVIIVLTVFAVSYIPFHVMKTMNLRARLDFQTPEMCDFND RVYATYQVTRGLASLNSCVDPILYFLAGDTFRRRLSRATRKASRRSEANLQSKSEEMTLN ILSEFKQNGDTSL
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Receptor for extracellular adenine nucleotides such as ADP. In platelets, binding to ADP leads to mobilization of intracellular calcium ions via activation of phospholipase C, a change in platelet shape, and ultimately platelet aggregation.
Gene References into Functions
P2Y1R plays a regulatory role in visceral hypersensitivity in rats with experimental irritable bowel syndrome.PMID:28974901
These data are supporting the idea of a dynamic modulation of astrocytic processes by purinergic signal, strengthening the role of purines in brain homeostasis.PMID:27318677
Data indicate the involvement of P2Y1Rs in interleukin-1beta (IL-1beta) mediated pain in both naive and carrageenan injected rats. There is a positive interaction between peripheral P2Y1Rs and interleukin-1 receptors in both IL-1beta and carrageenan-induced thermal hypersensitivity.PMID:28153540
Synergistic inhibition of both P2Y1 and P2Y12 adenosine diphosphate receptors by GLS-409 immediately attenuates platelet-mediated thrombosis and effectively blocks agonist-stimulated platelet aggregation irrespective of concomitant aspirin therapy.PMID:26743169
Data demonstrate that P2X7 and P2Y1 activation contributes to early damage induced by oxygen and glucose deprivation in the dentate gyrus (DG) with perhaps additional role for P2Y1 receptors in promoting cell proliferation and maturation in the DG.PMID:25526634
Results suggest that activation of P2Y1 receptors in the medial prefrontal cortex impairs inhibitory control and behavioral flexibility mediated by increased mesocorticolimbic activity and local disinhibitionPMID:25027332
P2Y1 receptors are a potential pharmacological target leading smooth muscle relaxation to treat spasticity in colonic motor disorders.PMID:24998877
Results suggest that peripheral activation of P2Y1, P2Y6 and P2Y11 receptors plays a pronociceptive role in formalin-induced pain.PMID:25449358
P2Y1 receptor-mediated potentiation of inspiratory motor output in neonatal rat in vitroPMID:24879869
FAM3A promotes proliferation and migration of vascular smooth muscle cells via P2Y1 receptor-mediated activation of Akt and ERK1/2 pathways.PMID:24857820
fibronectin upregulated the expression of P2Y1 receptor in spinal cord, and ATP could enhance the astrocytic proliferation and induce more release of arachidonic acid and prostaglandin E2 via P2Y1.PMID:24687862
P2Y1 receptors in astrocytes inhibit GABA transport through a mechanism dependent of P2Y1-mediated calcium signallingPMID:24733747
maintenance of an acidic environment in the ischemic hind paw of thrombus-induced ischemic pain rats results in the phosphorylation of TRPV1 receptors via a PKC-dependent pathway and P2Y1 receptor.PMID:24401144
It was concluded that the glomeruli podocytes and P2Y1 might be involved in the pathogenesis of glomerular injury and could be a target for treatment of kidney diseases.PMID:24048730
data identify P2Y1 receptors as key determinants of peripheral chemoreceptor regulation of breathing, sympathetic nerve activity, and blood pressurePMID:23753413
P2Y(1) -receptor-mediated vasodilatation is impaired in superior mesenteric arteries from long-term type 1 diabetic rats.PMID:22759594
The response of acinar cells to ATP is mediated by P2Y (especially P2Y) as well as by P2X purinoceptors.PMID:22065011
Data show that the inhibition of P2Y1 purinergic receptor (P2Y1R)-mediated extracellular signal-regulated protein kinase 1/2 (ERK1/2) phosphorylation in the spinal cord and dorsal root ganglia can attenuate nociception transmission.PMID:22349022
Critical roles are suggested for activating P2Yreceptors and mediating glioma cell mobility and migration, with changes in divalent calcium ions as a mechanistic link between activated receptor and functional response.PMID:21540076
In immunogold electron microscopy, labeling for P2Y1, P2Y6, and P2Y12 receptors were predominantly localized in the basal part of endothelial cells.PMID:21879346
P2ry1 and phosphorylated-RelA are localized in astrocytes and are key mediators of brain damage during ischemia and reperfusion injury.PMID:21487414
these data suggest that the reduction of Ca(2+) influx via voltage-gated Ca channels caused by the activation of P2Y(1) receptors by ATP is the possible mechanism for the inhibition of long-term depression in prefrontal cortex.PMID:20570683
NHERF2 selectively restricts downstream coupling of mGluR5 and P2Y1Rs in neurons to G(q)-mediated responses. Differential distribution of NHERF2 in neurons may therefore determine coupling of mGluR5 and P2Y1 receptors to calcium channels.PMID:20720114
in rat colon, a co-transmission process that involves ATP through P2Y1 receptors, and nitric oxide is present; P2Y1 receptors are responsible for the fast component of the inhibitory junction potentialsPMID:19906120
These observations indicate that astrocytic P2Y(1) receptor activation triggered glutamate efflux, which acts on distant neurons to elevate calcium levels or acts on nearby neurons to evoke inward current.PMID:19396875
ATP and adenosine play a complementary role in ischemic preconditioning through P2Y purinoceptors and adenosine receptorsPMID:11959647
Colocalization of P2Y1 receptors and neuronal NOS (nNOS) is demonstrated on neurons in the dorsomedial hypothalamic nucleus and suggests that P2Y1 receptors are involved in mediating nitric oxide production in the rat.PMID:12629523
Both P2Y1 and P2Y2 receptors are present in cerebral arterioles; Low amounts of ATP stimulate P2Y1 receptors and high levels activate P2Y2. Nitric oxide is involved in P2Y1 but not P2Y2 activation; potassium channels regulate the vasodilationPMID:12730558
Agonist activation of P2Y2 receptor by adenosine 5'-O-(3-thiotriphosphate) enhanced release of PGE2 from inner medullary collecting duct in time- and concentration-dependent fashion.PMID:12799304
immunostaining of pancreas from streptozotocin-diabetic rats revealed P2Y1 receptors present in intra-islet capillaries; P2Y1 and P2Y2 receptors present in pancreatic duct cells; and P2X1, P2X2, P2Y1 and P2Y2 receptors present in small blood vessels.PMID:12850289
P2Y as well as P2X receptor subtypes contribute to purinergic signalling in sensory ganglia.PMID:14564529
P2Y receptor-evoked Ca2+ mobilization in rat megakaryocytes is controlled by membrane voltage in a graded and bipolar manner without evidence for a discrete threshold potential.PMID:14645457
Slow binding sites could be assigned to the same P2Y1 receptor subtype in brain membranes while the 'fast' binding sites belong to other membrane-bound proteins, also interacting with ATP and its analogues.PMID:14729222
P2Y1 receptor was detected in a subset of taste bud cells of fungiform, foliate, and circumvallate papillae.PMID:15103469
P2Y1 receptors are in the apical membrane of the rat proximal tubule: receptor activation impairs acidification in this nephron segment.PMID:15172882
ATP acts on P2Y1 receptors coupled to Gq/11, resulting in the upregulation of oxidoreductase genes, leading to the protection of astrocytes against H2O2.PMID:15494980
the voltage dependence to Ca2+ release via Galphaq-coupled receptors is not due to control of G-proteins or down-stream signals but, rather, can be explained by a voltage sensitivity at the level of the P2Y1 receptor itselfPMID:15528188
In hippocampal slices, ATP activates P2Y1 receptors in the interneurons, which is linked to activation of unidentified excitatory conductance, through mechanisms distinct from those in the astrocytes.PMID:15574734
ATP analogs biphasically modulate the evoked release of glutamate from purified nerve terminals of the rat hippocampus, the inhibition being mediated by P2Y1, P2Y2, and/or P2Y4PMID:16000618
Extracellular ATP induces a transient contractile response in human and rat airways, mainly due to P2X receptors and extracellular Ca2+ influx in addition with, in IPB, P2Y receptors stimulation and Ca2+ release from intracellular Ca2+ stores.PMID:16336659
We conclude that ligand-receptor binding leads to rapid endocytosis in the cytoplasm of rat dorsal root ganglion neurons.PMID:16624826
Restricted feeding may enhance the sensitivity of the hypothalamus to extracellular ADP/ATP by regulation of the expression of P2Y1 receptors and of their signal transduction pathway via nitric oxide production.PMID:16643864
analysis of the coupling of purinergic P2Y1R to glutamate exocytosis and its peculiar TNFalpha- and PG-dependent controlPMID:16882655
Taken together, ATP, acting on P2Y(1) receptors, upregulates the PTP expression and its activity, which counteracts the H(2)O(2)-promoted death signaling cascades including ERK1/2 and its upstream signal src tyrosine kinase in astrocytes.PMID:16944453
This data indicates that P2Y1, P2Y2 and P2Y12 receptor proteins exist within mitochondria of astrocytes and C6 cells, although their role in these sub-cellular structures remains unclear.PMID:17292801
Data show that the P2Y1 receptor switches to neurons from glia in juvenile versus neonatal rat cerebellar cortex.PMID:17598884
The present results show a time-, region- and cell type-dependent in vitro and in vivo expression pattern of different P2 receptor subtypes in the dopaminergic system.PMID:17869006
P2Y(1)-mediated Ca(2+) sustain was at least in part via P2X receptors activated by the P2Y(1)-induced ATP release, and PKC played a pivotal role in desensitization of P2Y(1) receptors in RBA-2 astrocytesPMID:18072286
The P2Y(1)R-mediated frequency increase to ATP is likely to reflect activation of a mixed cationic conductance in multiple types of preBotC neurone than excitation of one, highly sensitive group.PMID:18174215
EFS-evoked norepinephrine outflow in the hippocampus is inhibited by P2Y1 receptors. Activation of facilitatory and inhibitory P2 receptors may participate in the modulation of NA release under ischemic-like conditions.PMID:18384646
Show
More
Hide
All
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Expressed in muscle, heart, liver, kidney, lung, brain, spleen, but not in testis.