MEGTPAANWSVELDLGSGVPPGEEGNRTAGPPQRNEALARVEVAVLCLILFLALSGNACV LLALRTTRHKHSRLFFFMKHLSIADLVVAVFQVLPQLLWDITFRFYGPDLLCRLVKYLQV VGMFASTYLLLLMSLDRCLAICQPLRSLRRRTDRLAVLGTWLGCLVASAPQVHIFSLREV ADGVFDCWAVFIQPWGPKAYVTWITLAVYIVPVIVLAACYGLISFKIWQNLRLKTAAAAA AAEGNDAAGGAGRAALARVSSVKLISKAKIRTVKMTFIIVLAFIVCWTPFFFVQMWSVWD VNAPKEASAFIIAMLLASLNSCCNPWIYMLFTGHLFHELVQRFFCCSARYLKGSRPGETS VSKKSNSSTFVLSRRSSSQRSCSQPSSA
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Receptor for oxytocin. The activity of this receptor is mediated by G proteins which activate a phosphatidylinositol-calcium second messenger system.
Gene References into Functions
oxytocin receptor binding density was higher in the dorsal lateral septum and nucleus accumbens shell in rats that underwent social instability stress.PMID:28739524
Pharmacological blockade of paraventricular nucleus oxytocin receptors prevented the anxiolytic effect of synthetic neuropeptide S.PMID:29118105
To investigate confounding effects of long-term antipsychotic medication, study treated rats with clozapine or haloperidol for 12weeks and assessed expression of the oxytocin receptor in cortical and subcortical brain regions; found no differences between antipsychotic-treated rats and controls.PMID:27132494
Oxytocin receptor binding density was higher in juveniles than in adults in regions associated with reward and socio-spatial memory and higher in adults than in juveniles in key regions of the social decision-making network and in cortical regions.PMID:27389643
A critical role for endogenous nucleus tractus solitarius OT-R signaling in mediating the intake-inhibitory effects of endogenous gastrointestinal satiation signals and in diet-induced thermogenesis.PMID:28575174
Results show that extracellular oxytocin release in the central amygdala is similar between males and females and that OTR in the central amygdala plays a causal role in the regulation of social interest toward juvenile conspecifics in males.PMID:27235738
These findings suggest a sex-specific role of the OTr in the Bed Nucleus Stria Terminalis in the regulation of social recognition.PMID:26630388
Oxytocin receptor expression was identified in calcitonin gene-related peptide containing trigeminal ganglion neurons.PMID:26590611
Blood Oxtr DNA methylation may reflect early experience of maternal care in rats.PMID:26122287
The present work demonstrates that even under identical endocrine circumstances, oxytocin receptor is differentially regulated in adipose tissue of obese rats depending on fat depot localisationPMID:25565097
This study demonstrated that hypothalamic OTR mRNA expression peaked during the neonatal period and subsequently decreased.PMID:25637830
first demonstration of the OTR localization in the islets of Langerhans immunohistochemicallyPMID:23500836
Repeated exposure to different caregiving environments, particularly maltreatment during the first postnatal week, produces long-term and age-dependent alterations in amygdala Bdnf, OXTr, and NPY gene expressionPMID:25011012
These findings showed that medial nucleus tractus solitarius (mNTS) neurons are a site of action for oxytocin receptor signaling in food intake control.PMID:25740340
Overexpression of oxytocin receptors in the hypothalamic paraventricular nucleus increases baroreceptor reflex sensitivity and buffers BP variability in conscious ratsPMID:24834854
Cold water intake inhibits colonic motility partially through oxytocin-oxytocin receptor signaling in the myenteric nervous system pathway, which is estrogen dependent.PMID:25152590
Oxytocin elicits satiety through both central and peripheral oxytocin receptors in male rats.PMID:24877632
There are robust sex differences in OTR binding densities in multiple forebrain regions of rats and OTR binding densities correlate with social interest in brain region- and sex-specific ways.PMID:24055336
Copulation stimulated OTR mRNA expression in the medial preoptic area of male rats, irrespective of previous sexual experience. Sexually experienced males had higher levels of OTR protein in the MPOA than sexually naive males and first-time copulators.PMID:23474276
Evidence for the existence of dopamine d2-oxytocin receptor heteromers in the ventral and dorsal striatum with facilitatory receptor-receptor interactionsPMID:22824810
OTR is expressed predominantly in non-peptidergic C-fiber cell bodies, but not in peptidergic or mechanoreceptor afferents or in skin nociceptive terminalsPMID:23102456
data suggeset that OT receptors modulate blood oxygen level-dependent activation in response to a novel and respulsive odor such as butyric acidPMID:23219972
activation of cardiac OT receptors by OT released in response to stress may participate in cardioprotection and inhibition of myocardial IR injury.PMID:22044052
A transient type of oxytocin receptor may be functioning in neuronal development during the neonatal period.PMID:21820489
OXTR participates in modulation of maternal behavior in rats, while other emotional behaviors are less related to such behavior.PMID:22178314
Data suggest that oxytocin and its receptors may have function as a cardiovascular hormone.PMID:22286791
The potentiation of a social hierarchy induced by stress is accompanied by social status- and region-specific changes in the expression of oxytocin receptor mRNA in the medial amygdala 3 h after the social encounter.PMID:21750583
Data indicate that RWIS activates both oxytocinergic and vasopressinergic neurons in the PVN and SON, which may project to the NTS or DMV mediating the activity of the neurons by OTR and V(1b)R.PMID:21858088
Demonstrate that cardiac OTRs are involved in the regulation of cardiac function of ovariectomized spontaneously hypertensive rats.PMID:20671291
Angiotensin IV elevates oxytocin levels in the rat amygdala and produces anxiolytic-like activity through subsequent oxytocin receptor activation.PMID:20224888
The results obtained in the present study demonstrate that OTR interaction with mGluR1a is required to initiate rapid cell signalling, resulting in a rapid elevation of Ca2+ flux in hypothalamic astrocytes.PMID:19807846
signaling via the OTR appears to inhibit estrogen-induced cell proliferation, suggesting that signaling by this receptor might help mediate the protective effect of pregnancy on utrerine leiomyomasPMID:12517588
central actions of oxytocin receptor during late gestation are necessary for the normal timing of systemic release of oxytocin during suckling, normal pup weight gain, and maintenance of maternal body weight.PMID:12834434
differences in intracerebral release patterns of oxytocin, rather than differences at the level of oxytocin receptors, are critical for the regulation of maternal aggressive behaviorPMID:16033890
Marked hypertension-induced reduction in oxytocin receptor mRNA expression, not altered by training.PMID:16157794
Data show that cocaine reduces oxytocin receptor binding density in the ventromedial hypothalamus and bed nucleus of the stria terminalis, but not the amygdala, and has no significant effect on oxytocin mRNA production in the paraventricular nucleus.PMID:16677710
Oxytocin receptors differentially signal via Gq and Gi proteins in pregnant and nonpregnant rat uterine myocytes.PMID:17170070
both oxytocin neuronal activity and the oxytocin receptor expression on GnRH cells are not influenced by oestrogenPMID:17504438
Neonatal oxytocin treatment modulates oxytocin receptor in rat myocardium.PMID:17537544
There are dynamic region-dependent changes in OTR-expressing cells at parturition. This altered OTR distribution pattern in the brain perinatally reflects the crucial role oxytocin plays in orchestrating both birth and maternal behavior.PMID:17628000
OT release in the ventromedial hypothalamus mediates the effects of vaginal stimulation on the induction of the PRL secretion needed to establish pseudopregnancyPMID:18006631
Brain oxytocin receptors mediate ejaculation elicited by 7-hydroxy-2-(di-N-propylamino) tetralin (7-OH-DPAT) in anaesthetized rats.PMID:18469843
Changes in oxytocin receptor, ERalpha and ERbeta mRNA levels during proestrus and estrus following pseudopregnancy are similar to those during the normal estrous cyclePMID:19057146
study provides evidence that stimulation of the brain oxytocin receptors by endogenous oxytocin plays significant role in inhibition of cardiovascular responses to stress.PMID:19258669
The oxytocin receptor is expressed on the smooth muscle of the stomach and mediates excitatory effect of oxytocin on gastric motility.PMID:19309416
oxytocin and its receptors are involved in nociceptive modulation in the central nucleus of amygdala of rats.PMID:19429063