MAFDDKMKPVNGQPDQKSCGKKPKGLHLLSSTWWCPAAVTLAILCLVLSVTLIVQQTQLLQVSDLLKQYQANLTQQDHILEGQMSAQKKAENASQESKRELKEQIDTLTWKLNEKSKEQEKLLQQNQNLQEALQRAVNASEESKWELKEQIDILNWKLNGISKEQKELLQQNQNLQEALQKAEKYSEESQRELKEQIDTLSWKLNEKSKEQEELLQQNQNLQEALQRAANSSGPCPQDWIWHKENCYLFHGPFNWEKSRENCLSLDAQLLQISTTDDLNFVLQATSHSTSPFWMGLHRKNPNHPWLWENGSPLSFQFFRTRGVSLQMYSSGTCAYIQGGVVFAENCILTAFSICQKKANLLLTQ
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Receptor that mediates the recognition, internalization and degradation of oxidatively modified low density lipoprotein (oxLDL) by vascular endothelial cells. OxLDL is a marker of atherosclerosis that induces vascular endothelial cell activation and dysfunction, resulting in pro-inflammatory responses, pro-oxidative conditions and apoptosis. Its association with oxLDL induces the activation of NF-kappa-B through an increased production of intracellular reactive oxygen and a variety of pro-atherogenic cellular responses including a reduction of nitric oxide (NO) release, monocyte adhesion and apoptosis. In addition to binding oxLDL, it acts as a receptor for the HSP70 protein involved in antigen cross-presentation to naive T-cells in dendritic cells, thereby participating in cell-mediated antigen cross-presentation. Also involved in inflammatory process, by acting as a leukocyte-adhesion molecule at the vascular interface in endotoxin-induced inflammation. Also acts as a receptor for advanced glycation end (AGE) products, activated platelets, monocytes, apoptotic cells and both Gram-negative and Gram-positive bacteria.
Gene References into Functions
an important role of LOX-1 in the maintenance of PASMCs phenotype.PMID:29069578
data support an important role for STBEVs in impairment of vascular function via activation of LOX-1 and reduced nitric oxide mediated vasodilation. Moreover, we postulate that the LOX-1 pathway could be a potential therapeutic target in pathologies associated with vascular dysfunction during pregnancyPMID:28672042
Negative feedback regulation between let-7g and LOX-1 mediated hypoxia-induced proliferation of in pulmonary artery smooth muscle cells (PASMCs).PMID:28108289
LOX-1 promotes right ventricular hypertrophy in hypoxia-exposed ratsPMID:28259654
Losartan attenuated lung injury by suppressing LOX-1 expression to alleviate inflammation and cell apoptosis.PMID:26884836
Swimming exercise reduced heart expression of LOX-1 receptor and free radical production in experimental diabetes.PMID:26432573
OLR1 is a novel molecular link between the proliferative and inflammatory responses of vascular smooth muscle cells.PMID:26305474
data indicated that olmesartan may attenuate the impairment of endothelial cell via down-regulation of the increased LOX-1 expression induced by ox-LDL.PMID:22408405
EETs exert beneficial effects on ox-LDL-induced inflammation primarily through the inhibition of LOX-1 receptor upregulation, MAPK phosphorylation, and NF-kappaB activation and through the upregulation of CYP2J4 expression.PMID:24486707
LOX-1 is a promising therapeutic target in neonatal HIE, and the inhibition of LOX-1 may become a novel treatment for babies who have experienced asphyxia.PMID:24731447
results indicate that LOX-1 is essential in microglia for promoting an inflammatory response in the presence of soluble neuronal-injury signals such as extracellular HSP60, thereby linking neuroinflammation and neurotoxicityPMID:22847064
LOX-1 activation by oxLDL and subsequent peroxynitrite generation as a novel mechanism by which disruption of the BBB occurs in EPE.PMID:23230281
These findings indicated that LOX-1 expression was up-regulated in the cortex of SHR and its expression has implication in neuronal apoptosis.PMID:22885180
In a rat model of preeclampsia, there is dramatic increase in expression levels of both LOX-1 receptor and endothelial NO synthase enzyme, along with increased superoxide production and modestly decreased endothelial function.PMID:22392901
Inhibition of rat LOX-1 receptor reduces leukocyte adhesion in experimental endotoxemia.PMID:21143965
Data show that a high fat diet elevates LOX-1 protein and mRNA expression in aorta, and that sleeve gastrectomy decreases plasma LDL levels, and downregulates LOX-1 protein and mRNA expression.PMID:21990956
LOX-1 appears to be involved in CRP-induced complement activation, and thus may serve to locate the site of CRP-induced complement activation and inflammation.PMID:21821723
enhanced expression and activation of LOX-1 mediated the enhancement of vascular permeability, which contributed to the vascular lipid accumulation under hypertensive statesPMID:20216085
expression pattern of LOX1-R in brain microvessels endothelial cells and its modulation by astrocytesPMID:12095612
findings indicate that myocardial ischemia-reperfusion upregulates LOX-1 expression, which through p38 MAPK activation increases the expression of MMP-1 and adhesion moleculesPMID:12384456
LOX-1 may have a role in the pathogenesis of osteoarthritis, inducing chondrocyte death through PI3 kinase/Akt pathway.PMID:12435393
LOX-1 is an adhesion molecule involved in leukocyte recruitment and may represent an attractive target for modulation of endotoxin-induced inflammationPMID:12538855
enhanced renal expression of olr1 might play some roles in the progression of chronic renal failure in rats.PMID:12661921
the bradykinin-eNOS and oxidative stress-LOX-1 pathway have roles in cardiovascular remodeling under chronic angiotensin-converting enzyme inhibitionPMID:16214149
LOX-1 activation driven by lipid oxidants in the preurine fluid is critical in inflammatory changesPMID:18322020
Oxidized low-density lipoprotein induces matrix metalloproteinase-9 expression at transcriptional and translational level in brain astrocytes, which are mediated through mitogen-activated protein kinase signaling pathways leading to AP-1 activation.PMID:18661553
Show
More
Hide
All
Subcellular Location
Cell membrane; Lipid-anchor. Cell membrane; Single-pass type II membrane protein. Membrane raft. Secreted.
Tissue Specificity
Predominantly expressed in lung and at lower level in kidney. Expressed in macrophages but not in vascular smooth muscle cells.