MSVRPFESPPPYRPDEFKPNHYAPSNDMYGGEMHVRPMLSQPAYSFYPEDEILHFYKWTS PPGVIRILSMLVIVMCIAVFACVASTLAWDRAYGTGIFGGSMNYPYGSGFGSYGGGFGGY GYGYGYGYGGYTDPRAAKGFLLAMAAFCFIASLVIFVTSVIRSGMSRTRRYYLIVIIVSA ILGIMVFIATIVYIMGVNPTAQASGSMYGSQIYTICSQFYTPGGTGLYVDQYLYHYCVVD PQEAIAIVLGFMIIVAFALIIVFAVKTRRKMDRYDKSNILWDKEHIYDEQPPNVEEWVKN VSAGTQDMPPPPSDYAERVDSPMAYSSNGKVNGKRSYPDSLYKSPPLVPEVAQEIPLTLS VDDFRQPRYSSNDNLETPSKRTPTKGKAGKAKRTDPDHYETDYTTGGESCDELEEDWLRE YPPITSDQQRQLYKRNFDAGLQEYKSLLAELDEVNKELSRLDRELDDYREESEEYMAAAD EYNRLKQVKGSADYKSKKNYCKQLKSKLSHIKRMVGDYDRRKT
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
May play a role in the formation and regulation of the tight junction (TJ) paracellular permeability barrier. May be involved in the organization of actin in endothelial cells.
Gene References into Functions
blood occludin levels correlate well with the extent of blood brain barrie damage.PMID:28079139
Both upregulation of claudin-4 and downregulation of occludin might increase paracellular NaCl transport in the kidney, resulting in impaired pressure natriuresis in SS rats.PMID:29179201
Up-regulation of miR-144 could promote intestinal hyperpermeability and impair the protective effect of the epithelial barrier by directly targeting OCLN and ZO-1.PMID:29258088
We provide quantitative evidence that claudin-11 contributes significantly to Sertoli cell tight junction function in vitro. Interestingly, occludin, which is hormonally regulated but not implicated in infertility until late adulthood, is also a significant contributor to barrier function.PMID:26585695
Mechanical ventilation can activate c-Src by phosphorylation and increase the degradation of occluding.PMID:25471013
In severe acute pancreatitis, downregulated expression of alphaSNAP in intestinal epithelial cells leads to reduced occludin expression, apoptosis of intestinal epithelial cells, and increased permeability of the intestinal barrier.PMID:25278303
actin cytoskeletal dynamics is detrimental to METH-induced BBB dysfunction by increasing internalization of occludin.PMID:24081143
cells transfected with Cx43 siRNA and grown in N medium showed significant downregulation in occludin (78 +/- 8% of control) and ZO-1 (81 +/- 6% of control) expression, and exhibited increased cell monolayer permeability.PMID:24008412
Results identified a crucial role of occludin in submandibular epithelial cells, and more importantly, demonstrated that occludin was required to mediate TRPV1-modulated paracellular permeability.PMID:23345400
High temperature inhibited the proliferation of rat Sertoli cells in vitro, and decreased the expression of OCLN.PMID:23297502
Disruption of pulmonary epithelium induced by hyperoxia is due in part to decreased expression of occludin and zona occludens (ZO)-1 proteins.PMID:22559818
Reverse-flow perfusions of mesenteric venules showed numerous small gaps in occludin expression on the endothelium. Similar gaps were not seen in vessels perfused in the forward direction.PMID:23417864
data indicate the possibility that interleukin 6 might be involved in the downregulation of occludin expression and in the modulation of blood-testis barrier permeability that occur in rats undergoing autoimmune orchitisPMID:23018187
Occludin and Zo-1 were reduced in intestinal mucosa both in mRNA and protein levels in the rat tail-suspension model.PMID:21336719
Occludin protein loss and claudin-5 redistribution are detected in ischemic microvessels following middle cerebral artery occlusion.PMID:22378877
Levels of tight junction protein occludin are decreased in blood-brain barrier cells post-translationally following exposure to neurotoxicants.PMID:20970449
A calcium-activated potassium channel activator increases blood-brain tumor-barrier permeability by down-regulating the expression of occludin.PMID:21334421
In female rats, increasing age and 17beta-estradiol treatment alters the expression of ERalpha and distinct blood-brain barrier tight-junction protein isoforms (occludin and claudin-5) without altering functional paracellular permeability.PMID:21192956
the evidence presented herein suggests the implication of occludin and, therefore, of blood-brain barrier in the pathophysiology of extrahepatic cholestasis.PMID:20170644
There was a significant down-regulation in the expression of occludin abd JAM-1 after exposure to microwave radiation.PMID:20180397
The presence of occludin in the tight junctions at the time of implantation suggests that the paracellular pathway is impermeable to water and Na(+) at this time, and that the transport of such substances takes place via the transcellular pathway.PMID:19555995
present in the junctions of the olfactory epithelium, and in the endothelial cells in the blood vessels in the lamina propria of the olfactory mucosaPMID:11751462
After ligation of the common bile duct, the expression of this protein was elevated in the liver.PMID:11845325
diabetes-related changes in cerebral zonula occludin-1 expression (zonula occludin-1)PMID:11958524
Occludin was immunoreactive at distal and proximal complexes of early differentiating ameloblasts and at distal regions of differentiating odontoblasts. However, in more advanced stages, occludin was only evident at the proximal complex of ameloblasts.PMID:15052661
In vitro blood-brain barrier model studies revealed that the pericyte-derived multimeric angiopoietin-1/Tie-2 pathway induces occludin expressionPMID:15056293
Taken collectively, the results reported herein support the notion that db-cAMP-induced TJ disruption was mediated by an induction of Itch protein expression, which in turn triggered the ubiquitination of occludin resulting in TJ disruption.PMID:15605377
The effect of matrix metalloproteinase(MMP) inhibitors on endothelial gap formation, occludin loss, and the ability of monocytes to pass the endothelium is reported.PMID:17065217
These findings indicate the opposite effects of the NMDA and AMPA/kainate receptors on occludin phosphorylation and disruption of the blood-brain barrier.PMID:17245419
Immunohistochemical expression of occludin and connexin 43 were decreased in the testis after vasal and epididymal ligation.PMID:17825302
The increase of BK-mediated BTB permeability is associated with the down-regulation of ZO-1, occludin, and claudin-5 and the rearrangement of F-actin;cAMP/PKA might be involved in the modulating process.PMID:18183615
Chronic ethanol ingestion impairs the airway epithelial barrier function through down-regulation and disruption of membrane localization of occludin and E-cadherin.PMID:18279593
Increased BBB permeability associated with peripheral inflammatory pain is promoted by the disruption of disulfide-bonded occludin oligomeric assemblies, which renders them incapable of forming an impermeant physical barrier to paracellular transport.PMID:18647175
The changes in occludin distribution and decreased expression of ZO-1 lead the reorganization of BBB-actin protein, which may be one of the mechanisms of permeability increasing of BBB following hypoxia-ischemia.PMID:18706176
Cardiopulmonary bypass markedly down-regulates the expression of occludin and ZO-1 proteins in intestinal mucosa of rats.PMID:18855986
a unique motif in the occludin sequence that is involved in the regulation of ZO-1 binding by reversible phosphorylation of specific Tyr residues.PMID:19017651
Transient focal ischemia increased the tyrosine phosphorylation of occludin in the isolated brain capillariesPMID:19319148
Occludin performs a structural role in inhibiting paracellular diffusion, and a signaling role involving interactions of dimeric and monomeric occludin isoforms within plasma membrane lipid raft domains.PMID:19457074
Fg binding to endothelial cells (ECs) alters expression of actin-associated endothelial tight junction proteins.PMID:19507189