Recombinant Rat NKG2-D type II integral membrane protein (Klrk1)

Code: CSB-CF012474RA
Size:
20μg
20μg100μg
US$4103
Quantity:
Express system: in vitro E.coli expression system
Species: Rattus norvegicus (Rat)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
Klrk1
Uniprot NO.
Alternative Names
Klrk1; Nkg2d; Nkrp2; NKG2-D type II integral membrane protein; Killer cell lectin-like receptor subfamily K member 1; NK cell receptor D; NK lectin-like receptor; NKLLR; NKG2-D-activating NK receptor; NKR-P2; CD antigen CD314
Species
Rattus norvegicus (Rat)
Source
in vitro E.coli expression system
Expression Region
1-215
Target Protein Sequence
MSKCHNYDLKPAKWDTSQEHQKQRSALPTSRPGENGIIRRRSSIEELKISPLFVVRVLVAAMTIRFTVITLTWLAVFITLLCNKEVSVSSREGYCGPCPNDWICHRNNCYQFFNENKAWNQSQASCLSQNSSLLKIYSKEEQDFLKLVKSYHWMGLVQSPANGSWQWEDGSSLSPNELTLVKTPSGTCAVYGSSFKAYTEDCSNPNTYICMKRAV
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Functions as an activating and costimulatory receptor involved in immunosurveillance upon binding to various cellular stress-inducible ligands displayed at the surface of autologous tumor cells and virus-infected cells. Provides both stimulatory and costimulatory innate immune responses on activated killer (NK) cells, leading to cytotoxic activity. Acts as a costimulatory receptor for T-cell receptor (TCR) in CD8(+) T-cell-mediated adaptive immune responses by amplifying T-cell activation. Stimulates perforin-mediated elimination of ligand-expressing tumor cells. Signaling involves calcium influx, culminating in the expression of TNF-alpha. Participates in NK cell-mediated bone marrow graft rejection. May play a regulatory role in differentiation and survival of NK cells. Binds to ligands belonging to various subfamilies of MHC class I-related glycoproteins.
Gene References into Functions
  1. Blockade of NKG2D significantly attenuated ischemia-reperfusion injury in a cardiac transplantation model. PMID:23953572
  2. Natural killer (NK) cell-activating receptor NKG2D is important for NK-mediated killing of hepatoma McA tumor cells; NK cell cytotoxicity against McA-RH7777 is mediated by both NKp30 and NKG2D. PMID:21106845
  3. NKG2D acts as a natural cytotoxicity receptor to stimulate perforin-mediated elimination of ligand-expressing tumor cells. PMID:12421908
  4. NKG2D is required for cytolysis of tumor cells, including autologous tumor cells from patients with ovarian cancer, and in vivo antitumor activity PMID:16339517
  5. We have reported the involvement of NKR-P2 in rat dendritic cell (DC) activation. We demonstrate the potential of agonistic anti-NKR-P2 mAb (1A6), which mimics the NKR-P2 ligand and induces activation and maturation of DCs. PMID:17369187
  6. A novel role of Irp94 as a ligand for NKR-P2 on DCs, which in turn executes both innate and adaptive immunity, was demonstrated. PMID:18178852
  7. In vitro cytotoxic assays reveal that a subset of rat monocytes/macrophages expressing both CD4 and CD8 antigens can kill certain tumor cells in a cell-cell contact-dependent manner through recognition of NKG2D ligands. PMID:18292522
  8. the splice forms of NKG2D arise from alternative promoters and that the NKG2D-L promoter is derived from a B1 retrotransposon. PMID:19304755

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type II membrane protein.
Tissue Specificity
Expressed by natural killer cells and by resting thoracic duct CD4+ and CD8+ T-cells, but not by thymocytes or other hemopoietic cells. Expressed by DC cells.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products