Klrk1; Nkg2d; Nkrp2; NKG2-D type II integral membrane protein; Killer cell lectin-like receptor subfamily K member 1; NK cell receptor D; NK lectin-like receptor; NKLLR; NKG2-D-activating NK receptor; NKR-P2; CD antigen CD314
Species
Rattus norvegicus (Rat)
Source
in vitro E.coli expression system
Expression Region
1-215
Target Protein Sequence
MSKCHNYDLKPAKWDTSQEHQKQRSALPTSRPGENGIIRRRSSIEELKISPLFVVRVLVAAMTIRFTVITLTWLAVFITLLCNKEVSVSSREGYCGPCPNDWICHRNNCYQFFNENKAWNQSQASCLSQNSSLLKIYSKEEQDFLKLVKSYHWMGLVQSPANGSWQWEDGSSLSPNELTLVKTPSGTCAVYGSSFKAYTEDCSNPNTYICMKRAV
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Functions as an activating and costimulatory receptor involved in immunosurveillance upon binding to various cellular stress-inducible ligands displayed at the surface of autologous tumor cells and virus-infected cells. Provides both stimulatory and costimulatory innate immune responses on activated killer (NK) cells, leading to cytotoxic activity. Acts as a costimulatory receptor for T-cell receptor (TCR) in CD8(+) T-cell-mediated adaptive immune responses by amplifying T-cell activation. Stimulates perforin-mediated elimination of ligand-expressing tumor cells. Signaling involves calcium influx, culminating in the expression of TNF-alpha. Participates in NK cell-mediated bone marrow graft rejection. May play a regulatory role in differentiation and survival of NK cells. Binds to ligands belonging to various subfamilies of MHC class I-related glycoproteins.
Gene References into Functions
Blockade of NKG2D significantly attenuated ischemia-reperfusion injury in a cardiac transplantation model.PMID:23953572
Natural killer (NK) cell-activating receptor NKG2D is important for NK-mediated killing of hepatoma McA tumor cells; NK cell cytotoxicity against McA-RH7777 is mediated by both NKp30 and NKG2D.PMID:21106845
NKG2D acts as a natural cytotoxicity receptor to stimulate perforin-mediated elimination of ligand-expressing tumor cells.PMID:12421908
NKG2D is required for cytolysis of tumor cells, including autologous tumor cells from patients with ovarian cancer, and in vivo antitumor activityPMID:16339517
We have reported the involvement of NKR-P2 in rat dendritic cell (DC) activation. We demonstrate the potential of agonistic anti-NKR-P2 mAb (1A6), which mimics the NKR-P2 ligand and induces activation and maturation of DCs.PMID:17369187
A novel role of Irp94 as a ligand for NKR-P2 on DCs, which in turn executes both innate and adaptive immunity, was demonstrated.PMID:18178852
In vitro cytotoxic assays reveal that a subset of rat monocytes/macrophages expressing both CD4 and CD8 antigens can kill certain tumor cells in a cell-cell contact-dependent manner through recognition of NKG2D ligands.PMID:18292522
the splice forms of NKG2D arise from alternative promoters and that the NKG2D-L promoter is derived from a B1 retrotransposon.PMID:19304755
Show
More
Hide
All
Subcellular Location
Cell membrane; Single-pass type II membrane protein.
Tissue Specificity
Expressed by natural killer cells and by resting thoracic duct CD4+ and CD8+ T-cells, but not by thymocytes or other hemopoietic cells. Expressed by DC cells.