Home
Product
Protein
Transmembrane Proteins
Recombinant Rat NKG2-D type II integral membrane protein (Klrk1)

Recombinant Rat NKG2-D type II integral membrane protein (Klrk1)

Code: CSB-CF012474RA

Rate （N/A）
Review （0）

Size:

20μg100μg

US$4103

Quantity:

Express system: in vitro E.coli expression system

Species: Rattus norvegicus (Rat)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

Klrk1

Uniprot NO.

O70215

Species

Rattus norvegicus (Rat)

Source

in vitro E.coli expression system

Expression Region

1-215

Target Protein Sequence

MSKCHNYDLKPAKWDTSQEHQKQRSALPTSRPGENGIIRRRSSIEELKISPLFVVRVLVAAMTIRFTVITLTWLAVFITLLCNKEVSVSSREGYCGPCPNDWICHRNNCYQFFNENKAWNQSQASCLSQNSSLLKIYSKEEQDFLKLVKSYHWMGLVQSPANGSWQWEDGSSLSPNELTLVKTPSGTCAVYGSSFKAYTEDCSNPNTYICMKRAV
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Functions as an activating and costimulatory receptor involved in immunosurveillance upon binding to various cellular stress-inducible ligands displayed at the surface of autologous tumor cells and virus-infected cells. Provides both stimulatory and costimulatory innate immune responses on activated killer (NK) cells, leading to cytotoxic activity. Acts as a costimulatory receptor for T-cell receptor (TCR) in CD8(+) T-cell-mediated adaptive immune responses by amplifying T-cell activation. Stimulates perforin-mediated elimination of ligand-expressing tumor cells. Signaling involves calcium influx, culminating in the expression of TNF-alpha. Participates in NK cell-mediated bone marrow graft rejection. May play a regulatory role in differentiation and survival of NK cells. Binds to ligands belonging to various subfamilies of MHC class I-related glycoproteins.

Gene References into Functions

Blockade of NKG2D significantly attenuated ischemia-reperfusion injury in a cardiac transplantation model. PMID:23953572
Natural killer (NK) cell-activating receptor NKG2D is important for NK-mediated killing of hepatoma McA tumor cells; NK cell cytotoxicity against McA-RH7777 is mediated by both NKp30 and NKG2D. PMID:21106845
NKG2D acts as a natural cytotoxicity receptor to stimulate perforin-mediated elimination of ligand-expressing tumor cells. PMID:12421908
NKG2D is required for cytolysis of tumor cells, including autologous tumor cells from patients with ovarian cancer, and in vivo antitumor activity PMID:16339517
We have reported the involvement of NKR-P2 in rat dendritic cell (DC) activation. We demonstrate the potential of agonistic anti-NKR-P2 mAb (1A6), which mimics the NKR-P2 ligand and induces activation and maturation of DCs. PMID:17369187
A novel role of Irp94 as a ligand for NKR-P2 on DCs, which in turn executes both innate and adaptive immunity, was demonstrated. PMID:18178852
In vitro cytotoxic assays reveal that a subset of rat monocytes/macrophages expressing both CD4 and CD8 antigens can kill certain tumor cells in a cell-cell contact-dependent manner through recognition of NKG2D ligands. PMID:18292522
the splice forms of NKG2D arise from alternative promoters and that the NKG2D-L promoter is derived from a B1 retrotransposon. PMID:19304755

Hide All

Subcellular Location

Cell membrane; Single-pass type II membrane protein.

Tissue Specificity

Expressed by natural killer cells and by resting thoracic duct CD4+ and CD8+ T-cells, but not by thymocytes or other hemopoietic cells. Expressed by DC cells.

Database Links

UNIGENE: Rn.14544

KEGG: rno:24934

STRING: 10116.ENSRNOP00000012886

Promotions