GGLLKYQTNLDTHPPGCISLNRTPSQNMSIADYVSEHFHGSLPGGFSKLEDHYQKTLVKI CLEEPKFQAHFPQTWIWISGPLCLYCAERLYRCIRSNKPVTIISVINHPSDVMELRMIKE NFKARPGQYIILHCPSVSALENHPFTLTMCPTETKATFGVHFKVVGDWTERFRDLLLPPS SQDSEILPFIQSRNYPKLYIDGPFGSPFEESLNYE
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
10xHis-SUMO-tag
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Constitutive NADPH oxidase which generates superoxide intracellularly upon formation of a complex with CYBA/p22phox. Regulates signaling cascades probably through phosphatases inhibition. May function as an oxygen sensor regulating the KCNK3/TASK-1 potassium channel and HIF1A activity. May regulate insulin signaling cascade. May play a role in apoptosis, bone resorption and lipolysaccharide-mediated activation of NFKB.
Gene References into Functions
chronic intermittent hypoxia-induced elevation of blood pressure is at least partially mediated via the Nox4-induced ROS/RhoA/ROCK pathwayPMID:28078487
This study, for the first time, demonstrates that Nox4 is an oxygen-sensing enzyme and a main ROS source in NP cells. Nox4-dependent ROS are genotoxic and a potent trigger of NP cell senescence. Nox4 is a potential therapeutic target for disc cell senescence and IDD.PMID:29147462
The results demonstrate that the heightened sensitivity of the brain to ischemic damage is due to an organ-specific role of NOX4 in blood-brain barrier endothelial cells and neurons.PMID:29087944
Results indicate that intermedin exerts anti-oxidant effects by inhibition of Nox4, and the effect can be mediated by cAMP-PKA pathway in unilateral ureteral obstruction induced renal fibrosis.PMID:28805491
CYLD contributes to the transdifferentiation of adventitial fibroblasts via deubiquitinating Nox4 and may play a role in vascular remodeling.PMID:28751569
Oxygen-glucose deprivation/reoxygenation increased MEG3 and NOX4 expression in rat brain microvascular endothelial cells.PMID:28634073
increased mTAL luminal flow results in increases in intracellular and mitochondrial H2O2, which are dependent on the presence of Nox4, and that p67phox/Nox2 accounts solely for increases in O2 (.-) productionPMID:27279484
Xbp1s plays an important role in NOX4-triggered cardiomyocyte hypertrophy via activating its downstream effector RIPK1, which may prove significant for the development of future therapeutic strategies.PMID:27929749
Nox4 activation in Vacular Smooth Muscle Cells contributes to actin depolymerization after hypoxia, which could be the underlying mechanism for myogenic tone impairment following ischemia/reperfusion.PMID:27558234
Upregulation of Nox4 is an important mechanism of cellular and mitochondrial oxidative stress leading to apoptotic cell death in cardiac myocytes following chronic beta- agonist stimulation.PMID:26631573
Luminal flow in thick ascending limbs leads to Nox4 recruitment to the nuclear region of thick ascending limb cells and an increase in O2 production.PMID:27033446
Acute restraint stress exacerbates the contractile hyper-reactivity in diabetic carotid arteries by enhancing Nox4 functionality.PMID:26387612
Hsp70 and CHIP mediates the ubiquitination and proteasomal degradation of Nox4 as part of the antioxidative effect of Losartan in spontaneous hypertensive rats.PMID:26279425
the reduced renal injury and attenuated blood pressure response to high salt in the SS(Nox4-/-) rat could be the result of multiple pathways by the knock out of Nox4.PMID:26644237
Glycated albumin increases the permissiveness of proximal tubular cells to fibrosis and apoptosis in vitro by triggering a pathway that involves Nox4.PMID:25681565
Results suggest that Nox4-mediated reactive oxygen species generation likely plays important role in fate determination and differentiation of neural crest stem cells.PMID:25410908
siNOX4 transfection markedly reduced rhBMP4-induced elevation of TRPC1 and 6 proteins.PMID:25203114
this study demonstrated a previously unrecognized protective role of Nox4, a ROS-generating enzyme and the major Nox isoform in CMECs, against H/R injury by inhibiting apoptosis and promoting migration and angiogenesisPMID:24480752
RhoA/ROCK is upstream of Poldip2-dependent Nox4 regulation and ROS production and induces redox signaling of kidney myofibroblast activation and may have broader implications in the pathophysiology of renal fibrosis.PMID:24872317
Nox4 is prominently expressed in the adventitia and contributes to altered fibroblast behavior, hypertensive vascular remodeling, and development of pulmonary hypertension.PMID:24947524
NOX4 activation is a decisive component in hepatic ischemia-reperfusion induced microcirculatory dysfunction.PMID:24636100
hyperglycemia could increase albumin permeability across the podocyte filtration barrier via Nox4-dependent PKGIalpha dimerizationPMID:24041960
Data show that hypercholesterolemia affects myocardial microRNA expression, and by down-regulating microRNA-25 increases NOX4 expression and consequently oxidative/nitrative stress in the heart.PMID:23722270
Atrial fibroblasts show greater fibrotic and oxidative responses to TGF-beta1 than ventricular fibroblasts and suggest role for Nox4.PMID:23884197
Increased 8-OHdG concentration in the culture medium and higher expression of Nox-1, Nox-4, and p22(phox) mRNAs (3-6-fold) were observed in cells treated with AGE3.PMID:23225244
these results indicate that IL-1beta-dependent activation of PKCdelta is modulated by NOX4-derived ROS.PMID:23022406
the thyroid gland of females is exposed to higher oxidative stress levels due both to increased reactive oxygen species (ROS) production through NOX4, and decreased ROS degradationPMID:23033809
Nox4D is a nuclear-localized and functionally active splice variant of Nox4 that may have important pathophysiologic effects through modulation of nuclear signaling and DNA damage in vascular cells.PMID:23393389
Phenylephrine increased Nox4 protein expression and cardiomyocyte hypertrophy in a dose-dependent manner in cultured neonatal rat heart cells.PMID:23271793
Telmisartan downregulates myocardial expression of Nox4 in type 2 diabetic rats.PMID:22873349
NOX4 is the main catalytic isoform of NADPH oxidase that contributes to oxygen production in the thick ascending limb of kidney.PMID:22875785
Study shows that testosterone induces vascular smooth muscle cells (VSMCs) migration via NADPH oxidase (Nox1 and Nox4 mRNA levels and p47phox)-derived reactive oxygen species (ROS) and c-Src-dependent pathways.PMID:22566500
Abnormal expression of NADPH oxidase plays an important role in progression of hypertensive renal damage in spontaneously hypertensive rats.PMID:21646815
In the aorta, Nox4 expression was increased by three-fold in obese rats.PMID:22195989
This study provides strong evidence that Nox4 is an important source of reactive oxygen species (ROS) in the left ventricle and that Nox4-derived ROS contribute to cardiomyopathy at early stages of type 1 diabetesPMID:22031600
Intracellular reactive oxygen species formation partly through an increasing NOX4 activity in response to high pacing frequency is associated with an increased atrial natriuretic peptide secretion.PMID:22063193
IGF-I induces an increase in expression of Nox4 in cultured renal proximal tubular epithelial cells.PMID:21940672
Expression of Nox4 was increased in vascular smooth muscle cells from SHR. Nox4,alone or in association,may be involved in NAD(P)H oxidase-mediated ROS production.PMID:21419746
High NOX4 expression is associated with colon cancers.PMID:20715105
Our results indicate that miR-25 as an endogenous gene silencing factor importantly contributes to the regulation of NOX4 gene expression in diabetic nephropathy.PMID:21071935
Bilirubin and biliverdin protect rodents against diabetic nephropathy by downregulating NAD(P)H oxidase.PMID:20686447
Upregulation of Nox4 by hypertrophic stimuli and aging induces oxidative stress, apoptosis and left ventricular dysfunction, via mitochondrial insufficiency caused by increased O(2)(-) production and cysteine oxidation in mitochondrial proteins.PMID:20185797
Translocation of Hsp70 to proximal tubule membranes in SHRLos might exert a cytoprotective effect by down-regulation of NADPH subunits Nox4.PMID:20016382
NADPH oxidase-derived reactive oxygen species is one of critical components of a signal transduction pathway that links puromycin aminonucleoside nephrosis to TRPC6-mediated Ca(2+) signaling.PMID:19910702
Nox4-based NAD(P)H oxidase and generation of reactive oxygen species mediate the effect of ANG II on Akt/PKB activation and protein synthesis in glomerular mesangial cellsPMID:12842860
Nox4 co-localizes with vinculin in focal adhesions in vascular smooth muscle cells. Its role may be correlated with its compartmentalization in focal adhesions.PMID:14670934
role for Nox4 as the major source of ROS in the kidneys during early stages of diabetesPMID:16135519
Nox4-derived reactive oxygen species are critical to the maintenance of the differentiated phenotype of vascular smooth muscle cells.PMID:17082491
blood pressure and angiotensin II type 1 receptor activation are involved in the up-regulation of Nox1 and Nox4 expression, which could contribute to vascular injury during chronic hypertensionPMID:17283869