MGNWLVNHWLSVLFLVSWLGLNIFLFVYVFLNYEKSDKYYYTREILGTALALARASALCL NFNSMVILIPVCRNLLSFLRGTCSFCNHTLRKPLDHNLTFHKLVAYMICIFTAIHIIAHL FNFERYSRSQQAMDGSLASVLSSLFHPEKEDSWLNPIQSPNVTVMYAAFTSIAGLTGVVA TVALVLMVTSAMEFIRRNYFELFWYTHHLFIIYIICLGIHGLGGIVRGQTEESMSESHPR NCSYSFHEWDKYERSCRSPHFVGQPPESWKWILAPIAFYIFERILRFYRSRQKVVITKVV MHPCKVLELQMRKRGFTMGIGQYIFVNCPSISFLEWHPFTLTSAPEEEFFSIHIRAAGDW TENLIRTFEQQHSPMPRIEVDGPFGTVSEDVFQYEVAVLVGAGIGVTPFASFLKSIWYKF QRAHNKLKTQKIYFYWICRETGAFAWFNNLLNSLEQEMDELGKPDFLNYRLFLTGWDSNI AGHAALNFDRATDVLTGLKQKTSFGRPMWDNEFSRIATAHPKSVVGVFLCGPPTLAKSLR KCCRRYSSLDPRKVQFYFNKETF
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Pyridine nucleotide-dependent oxidoreductase that generates superoxide and might conduct H(+) ions as part of its electron transport mechanism.
Gene References into Functions
Nox1 was able to increase SOD activity, thereby demonstrating its positive effect on the proliferation of MCTPASMCs.PMID:28849167
these data demonstrate that altered zinc distribution leading to accumulation of zinc in the mitochondria increases mitochondrial ROS production causing NF-kappaB activation which in turn upregulates Nox1 expression inducing senescence of vascular smooth muscle cellsPMID:28363602
Curcumin attenuated liver damage through the downregulation of Rac1, Rac1-GTP, and NOX1 as well as reduced oxidative stress in the serum and liver tissue of biliary duct-ligated rats.PMID:28336111
Studied the physiology of advanced oxidation protein products (AOPPs) in beta-cell destruction and dysfunction. Found exposure of cells to AOPPs induced an increase in Bax expression, caspase-3 activity, and apoptosis as well as a decrease in Bcl-2 expression. AOPP challenge rapidly increased the production of intracellular superoxide by activation of NADPH oxidases.PMID:28263293
Quercetin demonstrated hepatoprotective activity against BDL-induced liver injury through increasing antioxidant capacity of the liver tissue, while preventing the production of Rac1, and NOX1.PMID:28119263
NOX1 may be a critical effector of cardiovascular toxicity caused by smoking.PMID:27816504
Non-muscle myosin regulatory light chain (nmMLC20) could promote the senescence and dysfunctions of endothelial progenitor cells in pulmonary artery hypertension through up-regulation of NOX in a phosphorylation-dependent mannerPMID:26872992
NOX1 involvement in aASC cytostasis was reaffirmed when cells that were expanded under normoxic conditions in the presence of a specific NOX1 inhibitor, ML171, demonstrated reduced ROS accumulation, reduced apoptosis and long-term expansion.PMID:25880095
Urotensin II-increased reactive oxygen species production via the NADPH oxidase pathway is partially associated with activation of the PI3K/Akt and ERK cascadesPMID:26658815
Our data suggested that antihypertensive mechanisms of arctigenin were associated with enhanced eNOS phosphorylation and decreased NADPH oxidase-mediated superoxide anion generation.PMID:26585490
Activation of the NOX system and subsequent production of ROS are likely responsible for the downregulation of renal tubular Na/K-ATPase expression in early unilateral ureteral obstructionPMID:25997532
The activities of pentose phosphate pathway enzymes, NADPH oxidase (Nox), were measured, in brain of neonate rats subjected to a streptozotocin-induced neonatal hyperglycemia.PMID:25682169
Established are novel molecular mechanisms underlying oxidative stress-mediated dopaminergic neuronal death in which MMP3 activation is a key upstream event that leads to Nox1 induction and eventual dopaminergic neuronal death.PMID:25536219
messenger RNA expressions and protein levels of NADPH oxidase subunits were markedly reduced after IMP treated in SHR.PMID:24973900
Cyclic stretch initiates a signal through MEF2B that potentiates Nox1-mediated ROS production and causes VSMC to switch to a synthetic phenotype.PMID:25550204
This evidence implies that Nox1-mediated oxidative stress plays an important role in neuronal cell death and cognitive dysfunction in VaD. Nox1 may serve as a potential therapeutic target for VaD.PMID:24294978
In conclusion, B. trimera extracts exert antioxidant properties by scavenging ROS and decrease the expression of genes responsible by reactive species production in neutrophils.PMID:24372242
These results demonstrate that PKCdelta, NADPH oxidase, and oxidative stress play a causal role in FFA-induced hepatic insulin resistance.PMID:24824652
Upregulation of NOX-1 was found to be involved in cisplatin-induced nephrotoxicity.PMID:24211271
Suggest a critical role for NOX1 in the onset of spontaneous pulmonary arterial hypertension by regulating Kv1.5 and intracellular potassium levels.PMID:24233492
In dopaminergic neurons exposed to paraquat, protein kinase C(PKC)delta can regulate Nox1 expression.PMID:23827392
The expression of NOX1 was upregulated after IL-4 treatment for 4 h, but it was downregulated after 8-24 h. It was suppressesd by amyloid beta or dbcAMP.PMID:22565378
NADPH oxidase plays a key role in fructose-induced hepatic oxidative stress production and the mechanism of liver steatosis, suggesting its potential usefulness for the prevention/treatment of Type 2 diabetes mellitus.PMID:22738259
dopaminergic neurons are equipped with the Nox1/Rac1 superoxide-generating system. Stress-induced Nox1/Rac1 activation causes oxidative DNA damage and neurodegeneration.PMID:22098189
Both ET-1 activation of ET(A)/NADPH oxidase pathway and diminished antioxidants critically contribute to epithelial progenitor cells reduction and dysfunction via increased oxidative stress in salt-sensitive hypertension.PMID:22431579
NADPH oxidase and PKC contribute to increased Na transport by the thick ascending limb during type 1 diabetes.PMID:22203737
NOX is the main cellular source of the reactive oxygen species generated by hepatic stellate cells in response to leptin stimulation.PMID:21138635
Overtraining can activate the NADPH oxidase-mediated overproduction of ROS, leading to increased lipid peroxidation.PMID:21814483
An increase of NADPH oxidase-1 in hippocampus follows anxiety-like behavior and adjuvant arthritis.PMID:20970480
investigated roles and signal pathways of Nox1 expression involved in hypertrophy of vascular smooth muscle cells induced by aldosterone and revealed that activation of tyrosine kinase Src-ATF1 cascade was essential for aldosterone-Nox1 interactionsPMID:21505267
NADPH oxidase-dependent formation of reactive oxygen species mediates angiotensin II dependent epithelial-mesenchymal transition and accumulation of extracellular matrix in rat peritoneal mesothelial cells.PMID:21537828
Reactive oxygen species generated by flavoprotein NADPH oxidase may be involved in neuronal death in the pilocarpine model of epilepsy.PMID:20732386
Expression of Nox1 was increased in vascular smooth muscle cells from SHR. Nox1 regulation by Angiotensin II,but not Endothelin-1,is important in *O(2)(-) formation in VSMCs from SHR.PMID:21419746
High NOX1 expression is associated with colon cancers.PMID:20715105
NAD(P)H oxidase is an important source of superoxide in pancreatic islets and the activity of NAD(P)H oxidase is involved in the control of insulin secretion by palmitate.PMID:20857410
Rac1 induced NADPH oxidase activation, ROS generation and oxidative stress in the hippocampal CA1 region after cerebral ischemia.PMID:20830300
Rac1-mediated regulation of phagocyte-like NADPH oxidase contributes to cytokine-mediated mitochondrial dysfunction in the beta-cell.PMID:20943855
NOX1 might control autocrine cell growth of liver tumor cells through regulation of the EGFR pathwayPMID:20525691
NADPH oxidase up-expression is closely associated with hypertension in rats exposed to chronic intermittent hypoxia.PMID:19134410
Ang II stimulates TAL O2 production via activation of AT(1) receptors and PKC(alpha)-dependent NADPH oxidasePMID:20448043
Data report that the cell invasion activity was augmented in K-Ras-transformed normal rat kidney cells and attenuated by transfection of Nox1 small interference RNAs (siRNAs) into the cells.PMID:20018867
The presence of a O(2)(-*)-generating enzyme in close vicinity to the sites of neurotransmitter handling in the nerve fibers suggests the possibility of novel redox-mediated mechanisms in peripheral neurovascular control.PMID:19716351
increased HO-1 expression and CO decreases platelet-derived growth factor-stimulated VSMC migration via inhibition of Nox1 enzymatic activityPMID:19875720
Nox1 co-localizes with caveolin in punctate patches on the surface & along the cellular margins of vascular smooth muscle cells. Its role may be correlated with its compartamentalization in specific membrane signaling domains.PMID:14670934
NAD(P)H oxidase activity is inhibited by HO-1 by down-regulating cytochrome b558 expression via the reduction of heme availabilityPMID:15123630
transactivation of the EGF receptor and the activation of ERK1/2, PI3 kinase, and ATF-1 constitute the signaling pathways involved in the upregulation of NOX1PMID:15710429
iotensin II-related increased expression of NAD(P)H oxidase may play an important role in increased oxidative stress in islets of Type 2 diabetesPMID:15922295
NADPH oxidase may mediate ROS-induced apoptosis in pancreatic acinar cells in a Ca(2+)-dependent mannerPMID:16085178
nos2 expression is downregulated by bilirubin via inhibition of NAD(P)H oxidasePMID:16129699