MXNFTPVNGSSANQSVRLVTAAHNHLETVEMVFIATVTGSLSLVTVVGNILVMLSIKVNR QLQTVNNYFLFSLGCADLIIGAFSMNLYTLYIIKGYWPLGAVVCDLWLALDYVVSNASVM NLLIISFDRYFCVTKPLTYPARRTTKMAGLMIAAAWVLSFVLWAPAILFWQFVVGKRTVP DNQCFIQFLSNPAVTFGTAIAAFYLPVVIMTVLYIHISLASRSRVHKHRPEGPKEKKAKT LAFLKSPLMKPSIKKPPPGGASREELRNGKLEEAPPPALPPPPRPVPDKDTSNESSSGSA TQNTKERPPTELSTAEATTPALPAPTLQPRTLNPASKWSKIQIVTKQTGNECVTAIEIVP ATPAGMRPAANVARKFASIARNQVRKKRQMAARERKVTRTIFAILLAFILTWTPYNVMVL VNTFCQSCIPERVWSIGYWLCYVNSTINPACYALCNATFKKTFRHLLLCQYRNIGTAR
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
The muscarinic acetylcholine receptor mediates various cellular responses, including inhibition of adenylate cyclase, breakdown of phosphoinositides and modulation of potassium channels through the action of G proteins. Primary transducing effect is inhibition of adenylate cyclase.
Gene References into Functions
M1 and M4 muscarinic receptors are involved in shock-limiting and shock-activating processes, respectively, on the course of posthemorrhagic abnormalities in systemic and hepatic portal circulation.PMID:22803069
Muscarinic receptor expression is developmentally regulated; M1, M3, and M4 receptors were the main subtypes expressed in oligodendrocyte progenitor cells.PMID:21913336
M4 muscarinic acetylcholine receptors are up-regulated in dorsal root ganglion neurons and may account for increased muscarinic analgesic effects in a diabetic neuropathic pain model.PMID:21883220
CaMKII binds and phosphorylates M4 upon Ca2thorn influx to augment the antagonistic action of M4 on D1 signalling and on D1-mediated, cocaine-triggered hyperlocomotion.PMID:20551968
In a Ca(2+)-sensitive manner, CaMKIIalpha regulates M4 receptor efficacy and controls the acetylcholine-dopamine balance in the basal ganglia and also the dynamics of movement.PMID:20461055
novel role for M4 (Chrm4) in the regulation of protein synthesis through its interaction with eEF1A2.PMID:12048193
The m1-m5 muscarinic subtypes mapped to the following chromosomes: Chrm1, chromosome 1; Chrm2, chromosome 4; Chrm3, chromosome 17; Chrm4, chromosome 3; and Chrm5, chromosome 3.PMID:12433399
There is a significant reduction in the level of muscarinic M4 receptors in the spinal cord of acute and chronic arthritic rats compared to controls, suggesting that the M4 receptor subtype may be involved in cholinergic mechanisms of analgesia.PMID:12915263
These results suggest that a diet high in n-6 PUFA, but not of n-3 PUFAs or saturated fat, may selectively alter M2/M4 receptor-mediated signal transduction in the rat brain.PMID:15927789
Transient forebrain ischemia leads to dynamic alterations in the gene expression, protein prevalence, and functionality of muscarinic receptors in the post-ischemic hippocampus at times preceding the degeneration of the vulnerable neurons.PMID:15951192
evidence presented that stimulation of the muscarinic M4 receptor activates the pro-survival PI3K/Akt pathway to induce tuberin phosphorylationPMID:15979279
Data show that M1 muscarinic receptors contribute to, whereas M4 receptors inhibit, dopamine D1 receptor-induced [3H]-cyclic AMP accumulation in rat striatal slices.PMID:16758365
M4-type muscarinic receptors do not support behavioral flexibility.PMID:17709264
No m4-immunolabeling was detected in the rostral part of the thalamus.PMID:17845913
investigation of participation of M(4) receptors in neurotransmission at the hippocampal Schaffer collaterals-CA1 synapses; findings support permissive role of M(4) receptors & suggest their necessary participation in synaptic plasticity at these synapsesPMID:18816796
Receptor, Muscarinic M4 activated mTOR protein and its downstream molecule Ribosomal Protein S6 Kinases (70-kDa) in a 1-Phosphatidylinositol 3-Kinase-dependent manner.PMID:19070673