Home
Product
Protein
Transmembrane Proteins
Recombinant Rat Muscarinic acetylcholine receptor M4 (Chrm4)

Recombinant Rat Muscarinic acetylcholine receptor M4 (Chrm4)

Code: CSB-CF005384RA

Rate （N/A）
Review （0）

Size:

20μg100μg

US$6071

Quantity:

Express system: in vitro E.coli expression system

Species: Rattus norvegicus (Rat)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

Chrm4

Uniprot NO.

P08485

Alternative Names

Chrm4; Chrm-4; Muscarinic acetylcholine receptor M4

Species

Rattus norvegicus (Rat)

Source

in vitro E.coli expression system

Expression Region

1-478

Target Protein Sequence

MXNFTPVNGSSANQSVRLVTAAHNHLETVEMVFIATVTGSLSLVTVVGNILVMLSIKVNR QLQTVNNYFLFSLGCADLIIGAFSMNLYTLYIIKGYWPLGAVVCDLWLALDYVVSNASVM NLLIISFDRYFCVTKPLTYPARRTTKMAGLMIAAAWVLSFVLWAPAILFWQFVVGKRTVP DNQCFIQFLSNPAVTFGTAIAAFYLPVVIMTVLYIHISLASRSRVHKHRPEGPKEKKAKT LAFLKSPLMKPSIKKPPPGGASREELRNGKLEEAPPPALPPPPRPVPDKDTSNESSSGSA TQNTKERPPTELSTAEATTPALPAPTLQPRTLNPASKWSKIQIVTKQTGNECVTAIEIVP ATPAGMRPAANVARKFASIARNQVRKKRQMAARERKVTRTIFAILLAFILTWTPYNVMVL VNTFCQSCIPERVWSIGYWLCYVNSTINPACYALCNATFKKTFRHLLLCQYRNIGTAR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

The muscarinic acetylcholine receptor mediates various cellular responses, including inhibition of adenylate cyclase, breakdown of phosphoinositides and modulation of potassium channels through the action of G proteins. Primary transducing effect is inhibition of adenylate cyclase.

Gene References into Functions

M1 and M4 muscarinic receptors are involved in shock-limiting and shock-activating processes, respectively, on the course of posthemorrhagic abnormalities in systemic and hepatic portal circulation. PMID:22803069
Muscarinic receptor expression is developmentally regulated; M1, M3, and M4 receptors were the main subtypes expressed in oligodendrocyte progenitor cells. PMID:21913336
M4 muscarinic acetylcholine receptors are up-regulated in dorsal root ganglion neurons and may account for increased muscarinic analgesic effects in a diabetic neuropathic pain model. PMID:21883220
CaMKII binds and phosphorylates M4 upon Ca2thorn influx to augment the antagonistic action of M4 on D1 signalling and on D1-mediated, cocaine-triggered hyperlocomotion. PMID:20551968
In a Ca(2+)-sensitive manner, CaMKIIalpha regulates M4 receptor efficacy and controls the acetylcholine-dopamine balance in the basal ganglia and also the dynamics of movement. PMID:20461055
novel role for M4 (Chrm4) in the regulation of protein synthesis through its interaction with eEF1A2. PMID:12048193
The m1-m5 muscarinic subtypes mapped to the following chromosomes: Chrm1, chromosome 1; Chrm2, chromosome 4; Chrm3, chromosome 17; Chrm4, chromosome 3; and Chrm5, chromosome 3. PMID:12433399
There is a significant reduction in the level of muscarinic M4 receptors in the spinal cord of acute and chronic arthritic rats compared to controls, suggesting that the M4 receptor subtype may be involved in cholinergic mechanisms of analgesia. PMID:12915263
These results suggest that a diet high in n-6 PUFA, but not of n-3 PUFAs or saturated fat, may selectively alter M2/M4 receptor-mediated signal transduction in the rat brain. PMID:15927789
Transient forebrain ischemia leads to dynamic alterations in the gene expression, protein prevalence, and functionality of muscarinic receptors in the post-ischemic hippocampus at times preceding the degeneration of the vulnerable neurons. PMID:15951192
evidence presented that stimulation of the muscarinic M4 receptor activates the pro-survival PI3K/Akt pathway to induce tuberin phosphorylation PMID:15979279
Data show that M1 muscarinic receptors contribute to, whereas M4 receptors inhibit, dopamine D1 receptor-induced [3H]-cyclic AMP accumulation in rat striatal slices. PMID:16758365
M4-type muscarinic receptors do not support behavioral flexibility. PMID:17709264
No m4-immunolabeling was detected in the rostral part of the thalamus. PMID:17845913
investigation of participation of M(4) receptors in neurotransmission at the hippocampal Schaffer collaterals-CA1 synapses; findings support permissive role of M(4) receptors & suggest their necessary participation in synaptic plasticity at these synapses PMID:18816796
Receptor, Muscarinic M4 activated mTOR protein and its downstream molecule Ribosomal Protein S6 Kinases (70-kDa) in a 1-Phosphatidylinositol 3-Kinase-dependent manner. PMID:19070673