MTLHSNSTTSPLFPNISSSWVHSPSEAGLPLGTVTQLGSYNISQETGNFSSNDTSSDPLG GHTIWQVVFIAFLTGFLALVTIIGNILVIVAFKVNKQLKTVNNYFLLSLACADLIIGVIS MNLFTTYIIMNRWALGNLACDLWLSIDYVASNASVMNLLVISFDRYFSITRPLTYRAKRT TKRAGVMIGLAWVISFVLWAPAILFWQYFVGKRTVPPGECFIQFLSEPTITFGTAIAAFY MPVTIMTILYWRIYKETEKRTKELAGLQASGTEAEAENFVHPTGSSRSCSSYELQQQGVK RSSRRKYGRCHFWFTTKSWKPSAEQMDQDHSSSDSWNNNDAAASLENSASSDEEDIGSET RAIYSIVLKLPGHSSILNSTKLPSSDNLQVSNEDLGTVDVERNAHKLQAQKSMGDGDNCQ KDFTKLPIQLESAVDTGKTSDTNSSADKTTATLPLSFKEATLAKRFALKTRSQITKRKRM SLIKEKKAAQTLSAILLAFIITWTPYNIMVLVNTFCDSCIPKTYWNLGYWLCYINSTVNP VCYALCNKTFRTTFKTLLLCQCDKRKRRKQQYQQRQSVIFHKRVPEQAL
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
The muscarinic acetylcholine receptor mediates various cellular responses, including inhibition of adenylate cyclase, breakdown of phosphoinositides and modulation of potassium channels through the action of G proteins. Primary transducing effect is Pi turnover.
Gene References into Functions
Data suggest that, in atrial myocardium (or isolated cardiomyocytes), activation of muscarinic receptors M3 (Chrm3) leads to shortening of action potentials via suppression of L-type calcium channels; the major potassium channels are not affected, but inwardly rectifying potassium channels are suppressed.PMID:27858307
M1 and M3 muscarinic receptors may play a role in the neurotoxicity of anhydroecgonine methyl ester, a cocaine pyrolysis product.PMID:26626425
Our results suggest that the mechanism for the deficits in learning and memory of rats with chronic fluorosis may be associated with the decreased expressions of M1 and M3 in mAChRsPMID:25417050
The expression of beta3-adrenoceptor and muscarinic type 3 receptor immuno-reactivity in the major pelvic ganglion of the rat.PMID:25920933
The ventricular myocardium of rat pups differs from that of mature rats by a far greater sensitivity to selective stimulation of M3 receptors, suggesting an important functional role of M3 receptors in the newborn rats, which declines with age.PMID:26033578
Neonatal hypoglycemia decreased total muscarinic receptors (p < 0.001) with reduced muscarinic M1, M2, and M3 receptor genes (p < 0.001) in one month old rats.PMID:25474381
Expressions of M2R and M3R mRNA were increased in urothelial cells and decreased in detrusor muscles following chronic cystitis.PMID:25681120
Activation of muscarinic receptors leads to rapid activation of several kinases that regulates contraction of longitudinal muscle of colon.PMID:25891767
The relative mRNA expression of M3 and M5 mAChR in bones of a rat osteoporosis model, was investigated.PMID:24866457
The upregulation of M-mAChR during myocardial hypertrophy could relieve the hypertrophic response provoked by angiotensin II.PMID:24028210
Muscarinic M3 receptors are downregulated in the brain stem following spinal cord injury.PMID:23184186
These results suggest a complex antagonistic interplay between G(q)-activated PKC and Gbetagamma in regulation of L-VDCC, in which multiple cytosolic segments of alpha(1C) are involved.PMID:22990911
Muscarinic receptor expression is developmentally regulated; M1, M3, and M4 receptors are the main subtypes expressed in oligodendrocyte progenitor cells.PMID:21913336
Data suggest that Chrm3 is up-regulated in cell membranes of parotid glands in a model of periodontitis and participates in potassium release; Chrm3 expression appears to return to control level upon indomethacin treatment of periodontitis.PMID:22513211
M3 subtype of muscarinic acetylcholine receptor promotes cardioprotection via the suppression of miR-376b-5pPMID:22396777
Taurine supplementation of low-protein diet rats restored Ach-M3R, Synt1, SNAP-25 protein levels and increased sarcoendoplasmatic reticulum Ca2+-ATPase (SERCA) 3 protein expression in rats on a low-protein diet.PMID:21543213
NGF expression increased but M3 subtype muscarinic receptor expression decreased in the seminal vesicle of diabetic rats.PMID:22141271
activation of M3R dimers requires a conformational change of the N-terminal segment of the i3 loopPMID:22031716
structure of the G(q/11)-coupled M3 mAChR ('M3 receptor', from rat) bound to the bronchodilator drug tiotropium and identify the binding mode for this clinically important drugPMID:22358844
Our findings suggest an interaction between vitamin D(3) and muscarinic M3 receptors in regulating insulin secretion from pancreas.PMID:20655720
Expression of muscarinic receptor M1, M3, M5 subunits decreased in the flocculus after unilateral labyrinthectomy.PMID:19160866
study showed that M and M receptors, IP3 and cGMP were functionally regulated during diabetes as function of agePMID:21054404
Chrm3 receptor is located on presynaptic glutamatergic terminals afferent to the recorded pyramidal neuron, thus decreasing glutamate release.PMID:20600670
muscarinic M(1) receptor showed a significant decrease and muscarinic M(3) receptor subtype showed a significant increased binding in the cerebral cortex of hypoglycemic rats compared to diabetic and controlPMID:21126518
We found a tendency in the gene expression of muscarinic receptor subtypes from M2 toward M3 after birth trauma.PMID:20445960
NF-kappaB signalling plays an essential role in controlling the expression of the muscarinic M(3) receptor.PMID:20541544
Acetylcholine through muscarinic M1 and M3 receptors stimulated calcium release from the pancreatic islets.PMID:19554469
Increased beta-catenin activity is associated with M(3) mAChR's binding during myocardial infarction.PMID:19473345
Results highlight long-term low dose somatotropin and insulin treatment in regulating muscarinic M1 and M3 cholinergic and NMAR1 and mGluR5 glutamate receptor subtypes in aging rats and rejuvenation of brain function.PMID:19666081
An in situ disulfide cross-linking strategy reveals the structure of the inactive and active state of the M3 muscarinic receptor by location of residues in transmembrane (TM) I close to Cys532, a residue present in the central portion of TM VII.PMID:12056896
in normal bladders both M(2) and M(3) receptors can induce contraction and in the denervated bladder, the M(2) and the M(3) receptors interact in a facilitatory manner to mediate contraction.PMID:12185001
The m1-m5 muscarinic subtypes mapped to the following chromosomes: Chrm1, chromosome 1; Chrm2, chromosome 4; Chrm3, chromosome 17; Chrm4, chromosome 3; and Chrm5, chromosome 3.PMID:12433399
The presence of M3-like receptors on mesencephalic GABAergic neurones was confirmedPMID:14766941
evidence for the presence of M(2)- and M(3)-mAChR, at the mRNA and protein level, in the rat myometrium and that estrogen induces an increase in myometrial responsiveness to mAChR agonistsPMID:15062561
central muscarinic M1 and M3 receptor subtypes functional balance is suggested to regulate sympathetic and parasympathetic activity, which in turn control the islet cell proliferation and glucose homeostasisPMID:15350825
data suggest a conformational link between the highly conserved Asp-113, Arg-165, and Tyr-250 residues which is critical for receptor activationPMID:15572356
agonist activation of the M(3) muscarinic acetylcholine receptor results in pronounced conformational changesPMID:15870064
a conformational change occurs adjacent to the ligand-binding pocket of the M(3) muscarinic acetylcholine receptor after agonist bindingPMID:16093246
spontaneous contractions in the neonatal rat bladder are enhanced by activation of M2 and M3 receptorsPMID:16709645
Interaction of the third intracellular loop of SET protein with M3 muscarinic receptor (M3-MR) leads to reduced M3-MR signaling capacity.PMID:17065150
conclude that previously reported differences relate to the use of inhibitors rather than experimental protocols and that the overall data do not support a role for PLC in M(3) muscarinic receptor-mediated rat bladder contractionPMID:17596535
In reticular thalamic nucleus, the m3-immunolabeling was distributed in a large part of somata and in proximal dendrite shafts than in the distal dendrite region.PMID:17845913
Generation of an agonistic binding site for blockers of the M(3) muscarinic acetylcholine receptor.PMID:18237275
In the inflamed bladder, NO seems to be released via cholinergic stimuli through mucosal muscarinic M3/M5 receptors, presumably on urothelial cells, affecting bladder functionPMID:18246091
The muscarinic receptors in the rat gastric mucosal segments were composed of M(1), M(2) and M(3) subtypesPMID:18938154
Taken together, these results suggest that muscarinic M3 receptor is involved in the regulation of glucose uptake and/or lipolysis in adipose tissue.PMID:19111904
Stimulation of the presinaptic M1-muscarinic receptors of the bladder cholinergic nerve terminals and M3-muscarinic receptors located on the bladder detrusor muscle induce the release of urinary bladder-derived relaxant factor.PMID:19416629
results demonstrate that activation of muscarinic receptors exerts diverse effects on GABAergic transmission in the entorhinal cortexPMID:19494196
The muscarinic receptors present in undifferentiated Fisher-rat thyroid epithelial cells belong to the M(3) subtype. Their binding affinities for various antagonists was determined.PMID:19627722
increased PKC-epsilon activity is associated with M3-mAChR during myocardial ischemiaPMID:19685039