Recombinant Rat Mitofusin-1 (Mfn1)

Code: CSB-CF840297RA

Rate （N/A）
Review （0）

Size:

20μg100μg

US$8039

Quantity:

Express system: in vitro E.coli expression system

Species: Rattus norvegicus (Rat)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

Mfn1

Uniprot NO.

Q8R4Z9

Alternative Names

Mfn1; Fzo1b; Mitofusin-1; Mitochondrial transmembrane GTPase FZO1B; Transmembrane GTPase MFN1

Species

Rattus norvegicus (Rat)

Source

in vitro E.coli expression system

Expression Region

1-741

Target Protein Sequence

MAETVSPLKHFVLAKKAITAIFGQLLEFVTEGSHFVEATYRNPELDRIATEDDLVEIQGY RNKLAVIGEVLSRRHMKVAFFGRTSSGKSSVINAMLWDKVLPSGIGHTTNCFLSVEGTDG DKAYLMTEGSDEKKSVKTVNQLAHALHMDKDLKAGCLVHVFWPKAKCALLRDDLVLVDSP GTDVTTELDIWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNERLSKPNIFILNNRWD ASASEPEYMEDVRRQHMERCLHFLVEELKVVSPLEARNRIFFVSAKEVLNSRMNKAQGMP EGGGALAEGFQARLQEFQNFEQTFEECISQSAVKTKFEQHTIRAKQILDTVKNILDSVNV AAAEKRVYSMEEREDQIDRLDFIRNQMNLLTMDVKKKIKEVTEEVANKVSCAMTDEICRL SVLVDEFCSEFHPTPSVLKVYKSELNKHIEDGMGRNLADRCTSEVNASILQSQQEIIENL KPLLPAGIQNKLHTLIPCKKFDLSYDLNCHKLCSDFQEDIVFRFSLGWSSLVHRFLGSTN AQRVLLGLSEPIFQVPRSLASTPTAPSNPAAPDNAAQEELMITLITGLASLTSRTSMGII VVGGVIWKTVGWKLISVTLSMYGALYLYERLTWTTRAKERAFKQQFVNYATEKLQMIVKF TSANCSHQVQQEMATTFARLCQQVDVTQKHLEEEIARLSKEIDQLEKIQNNSKLLRNKAV QLERELENFSKQFLHPSSGES
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Mitochondrial outer membrane GTPase that mediates mitochondrial clustering and fusion. Membrane clustering requires GTPase activity. It may involve a major rearrangement of the coiled coil domains. Mitochondria are highly dynamic organelles, and their morphology is determined by the equilibrium between mitochondrial fusion and fission events. Overexpression induces the formation of mitochondrial networks (in vitro). Has low GTPase activity.

Gene References into Functions

Hypoxia leads to upregulation of mitofusin 1 (Mfn1) both in vivo and in vitro. Mfn1 is involved in hypoxia-induced PASMCs proliferation. Mfn1-mediated mitochondrial homeostasis is regulated by miR-125a. MiR-125a plays a role in PASMCs oxidative phosphorylation and glycolysis. PMID:28593577
results implied that HO-1 upregulation suppressed oxidative stress induced by LPS, and the possible mechanism could be associated with Mfn1 and the PI3K/Akt pathway. PMID:27830717
Studied role of plant-derived miR5338 in Mfn1 inhibition in rape bee pollen treatment for benign prostatic hyperplasia. PMID:29382326
In the renal tissues of rats with chronic fluorosis, expression of both Mfn1 protein and mRNA was clearly reduced, whereas that of Fis1 was elevated. PMID:24958380
Data identify MFN1 as an ERK target to modulate mitochondrial shape and apoptosis. PMID:25801171
Mfn1 and miR-140 are integrated into the program of cardiomyocyte apoptosis. PMID:24615014
Physical exercise is identified as a preventive measure to promote mitochondrial function and expressions of mitofusin, BDNF and antioxidant in brain, so as to protect brain energy metabolism against chronic mild stress. PMID:22244747
The Mfn 1 could inhibit the activation of caspase-3 and caspase-9, which are necessary for endonuclease G translocation to the nucleus. PMID:20594982
Fis1 and Mfn1 activities influence mitochondrial signal generation thereby insulin exocytosis. PMID:18832378

Hide All

Subcellular Location

Mitochondrion outer membrane; Multi-pass membrane protein.

Protein Families

TRAFAC class dynamin-like GTPase superfamily, Dynamin/Fzo/YdjA family, Mitofusin subfamily

Tissue Specificity

Ubiquitous. In brain, it is expressed at weaker level than MFN2, while it is expressed at a higher level than MFN2 in heart and testis. Expressed at high level in elongating spermatids of seminiferous tubules.

Database Links

UNIGENE: Rn.160939

KEGG: rno:192647

STRING: 10116.ENSRNOP00000060265

Promotions