Ucp2; Slc25a8; Mitochondrial uncoupling protein 2; UCP 2; Solute carrier family 25 member 8
Species
Rattus norvegicus (Rat)
Source
in vitro E.coli expression system
Expression Region
1-309
Target Protein Sequence
MVGFKATDVPPTATVKFLGAGTAACIADLITFPLDTAKVRLQIQGESQGLARTAASAQYR GVLGTILTMVRTEGPRSLYNGLVAGLQRQMSFASVRIGLYDSVKQFYTKGSEHAGIGSRL LAGSTTGALAVAVAQPTDVVKVRFQAQARAGGGRRYQSTVEAYKTIAREEGIRGLWKGTS PNVARNAIVNCTELVTYDLIKDTLLKANLMTDDLPCHFTSAFGAGFCTTVIASPVDVVKT RYMNSALGQYHSAGHCALTMLRKEGPRAFYKGFMPSFLRLGSWNVVMFVTYEQLKRALMA AYESREAPF
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
UCP are mitochondrial transporter proteins that create proton leaks across the inner mitochondrial membrane, thus uncoupling oxidative phosphorylation from ATP synthesis. As a result, energy is dissipated in the form of heat.
Gene References into Functions
The present results highlight the neuroprotective actions of UCP2, acting in the inhibition of apoptotic factors and oxidative stress, to increase neuron survival after SE onset.PMID:30159115
These data suggested that atorvastatin significantly attenuated the myocardial remodeling by downregulating the expression of UCP2 that was found to improve the myocardial energy metabolism, inhibit myocardial hypertrophy, and eventually reduce myocardial remodeling.PMID:29559841
Obesity-alleviating potential of asiatic acid and its effects on ACC1, UCP2, and CPT1 mRNA expression in high fat diet-induced obese Sprague-Dawley rats.PMID:28993954
UCP2 inhibits myointimal hyperplasia after vascular injury, probably through suppressing nuclear factor-kappaB-dependent smooth muscle cell proliferation and migration.PMID:29025747
microRNA-503 significantly contributes to mediate brain UCP2 downregulation.PMID:28640254
The findings demonstrated that the UCP2 and NLR family-pyrin domain-containing 3/caspase 1/interleukin 1beta signaling pathway may be involved in intestinal barrier injury and that GIK treatment decreased intestinal barrier permeability.PMID:28428961
GLP-1 likewise increased the synthesis of GR and favored the translocation of the nuclear transcription factor erythroid 2p45-related factor (Nrf2)..Glucose-stimulated insulin secretion was also preserved in beta-cells challenged with tert-BOOH but pre-treated with GLP-1, probably through the down-regulation of the mitochondrial uncoupling-protein2 (UCP2).PMID:26968794
UCP2 has an apoptotic effect in beta cells via regulation of the intrinsic pathway of apoptosis in brain dead organ donors.PMID:28222054
These observations suggest that downregulation of UCP2 expression in the hypothermic preserved rat heart in part initiated the protective mechanism via the SIRT1 pathway.PMID:27356851
study showed that the expression of UCP2 varies according to age and the severity of obesity and supports the widely held notion that increased UCP2 expression is an adaptive response to increased fatty acid beta-oxidation and reactive oxygen species production that occurs during obesityPMID:26621256
In the lungs and the spleen of rats with a chronic alcohol diet cytochrome c release from mitochondria was significantly increased. Both organs did not show any altered gene and protein expression of UCP-2.PMID:26664262
The expression level of UCP2 is closely correlated with mitochondrial injury in sepsis rat model.PMID:26903064
The iPLA2gamma/UCP2 synergy provides a feedback antioxidant mechanism preventing oxidative stress by physiological fatty acid intake in pancreatic beta-cells, regulating glucose-, fatty acid-, and redox-stimulated insulin secretion.PMID:25925080
data demonstrate that mitochondrial morphology and funtion are damaged in cardiomyocytes under septic conditions, while the silencing of UCP2 using siRNA aggravated this processPMID:25873251
propose mitochondrial uncoupling protein-2 manipulation as a potential strategy for redirecting microglial response towards protective phenotypesPMID:26173855
The aim of this study was to investigate the early changes of cardiac uncoupling protein-2 (UCP2) expression following myocardial ischemia reperfusion in rats chronically treated with ramiprilat and losartan.PMID:23372044
Indoxyl sulfate-induced cardiomyocytes hypertrophy was partly due to the inhibition of AMPK/UCP2 signaling and the enhancement of oxidative stress.PMID:25703824
Vitamin D deficiency decreases adiposity in rats and causes altered expression of uncoupling proteins and steroid receptor coactivator3PMID:25132457
Chronic alcohol consumption leads to a cerebral induction of UCP-2 (and UCP-4).PMID:23800309
miR-30e/UCP2 axis has an important role in mediating TGF-beta1-induced epithelial-mesenchymal transition and kidney fibrosis.PMID:23515048
The expression of SIRT1 is significantly lowered and UCP2 increased in the liver of rats with T2DM and NAFLD.PMID:22588935
Expression of hippocampal UCP2 increases 12 to 48 hours after status epilepticus is induced.PMID:22849356
Resveratrol up-regulates hepatic UCP2 expression and prevents the development of nonalcoholic fatty liver disease in a high-fat diet-treated rodent model.PMID:23084643
UCP2 is a critical protein to prevent oxidative stress damage in renal mesangial cells in vitro.PMID:23297375
Pingtang recipe containing drug-serum shows a protective effect on INS-1 beta pancrentic cells against lipoapoptosis by regulating ROS production and UCP-2 expression.PMID:21179742
blockade of the diabetes-induced upregulation of UCP- 2 results in excessive uncoupling and reduced oxidative stress in the kidney via activation of ANT.PMID:22768304
After vagotomy, ATP contents decreased and UCP2 expression was downregulated in the stomach corpus.PMID:21162199
UCP2 mRNA expression in the hypothyroidism group was significantly lower than that of control group.PMID:21190599
The expression of UCP2 mRNA in the liver failure group was higher as compared to the control group. Expression may be related to levels of SOD, MDA and endotoxin.PMID:21272461
Ucp2 and PPARdelta gene and protein expression increased in rats fed a fructose-rich diet.PMID:21855553
Berberine can down-regulate the expression levels of UCP2 mRNA and UCP2 proteins of hepatic tissue in non-alcoholic fatty liver disease rats.PMID:21359922
UCP2 plays both regulatory and protective roles in beta cells by acutely lowering glucose-stimulated insulin secretion and chronically preventing oxidative stress.PMID:21172424
The frequency of beta cell apoptosis in high-fat feeding rats is affected by oxidative stress, which results in increasing UCP2 gene expression.PMID:20014488
UCP2 expression is rapidly induced via the peroxisome proliferator-activated receptor pathway, thereby increasing cell apoptosis in adult rat cardiomyocytes.PMID:20010438
The expression of UCP2 was upregulated in pressure overload induced failure heart and might be responsible for decreased myocardial adenine nucleotide and energy metabolism disturbance.PMID:20193183
PGC-1alpha is induced by cerebral ischemia leading to upregulation of UCP2 and SOD2, thereby providing a neuroprotective effect against ischemic brain injury in the hippocampus by ameliorating oxidative stressPMID:19774674
induced by long-term cold exposure, promoting decoupling of oxidative phosphorylationPMID:11710805
UCP-2 mRNA is induced by fatty acid oxidation in beta-cellsPMID:11897694
energy metabolism and expression of uncoupling protein 2 in brown adipose tissue after 21 days of recovery from intracerebroventricular mouse leptin in ratsPMID:12062312
superoxide (or its products) exerts its uncoupling effect by activating the proton transport mechanism of UCP2 at the matrix side of the mitochondrial inner membranePMID:12372827
The down-regulation of heartUCP2 parallels the lower lipid utilization which may account for an enhanced fat deposition in dietary obese ratsPMID:12435081
Thiazolidinediones indirectly stimulate ucp2 transcription by inducing-via PPARgamma-limiting amounts of a protein, which must be phosphorylated by MAPK to stimulate the gene.PMID:12588051
Triiodothyronine selectively enhances transcriptional stimulation of ucp2 by thiazolidinediones and nonselective PPAR ligands by priming the gene to a transactivating signal(s) generated by such ligands.PMID:12588052
Effects of dietary protein content on uncoupling proteins (UCP) 1, 2 and 3 expression in various tissues of Zucker lean and obese rats were studiedPMID:12603007
induction of electrogenic ion transport rather than electrophoretic fatty acid activity induced expression of hepatic uncoupling protein 2 (UCP-2) in ratsPMID:12756242
data argue against the hypothesis that UCP-2 causes decreased cardiac mechanical efficiency in septic shockPMID:12785014
Data suggest that uncoupling protein-2 is an inducible protein that is neuroprotective by activating cellular redox signaling or by inducing mild mitochondrial uncoupling that prevents the release of apoptogenic proteins.PMID:12858170
Down-regulation of UCP-2 mRNA by IL-1beta is an early event of cytokine interaction with beta-cells which is not directly coupled to cell toxicity.PMID:12967645
UCP2 appears to be regulated by the excitatory stimulus via the cAMP-PKA cascade and serves to negatively control the synaptic output by reducing intracellular ATP levelsPMID:14511123
Sympathetic sympathetic tonus generated by exposure of rats to cold induces the expression of PGC-1, which participates in the control of UCP-2 expression in pancreatic islets.PMID:14576981