Ucp1; Slc25a7; Ucp; Mitochondrial brown fat uncoupling protein 1; UCP 1; Solute carrier family 25 member 7; Thermogenin
Species
Rattus norvegicus (Rat)
Source
in vitro E.coli expression system
Expression Region
2-307
Target Protein Sequence
VSSTTSEVQPTMGVKIFSAGVSACLADIITFPLDTAKVRLQIQGEGQASSTIRYKGVLGT ITTLAKTEGLPKLYSGLPAGIQRQISFASLRIGLYDTVQEYFSSGRETPASLGSKISAGL MTGGVAVFIGQPTEVVKVRMQAQSHLHGIKPRYTGTYNAYRVIATTESLSTLWKGTTPNL MRNVIINCTELVTYDLMKGALVNHHILADDVPCHLLSALVAGFCTTLLASPVDVVKTRFI NSLPGQYPSVPSCAMTMYTKEGPAAFFKGFAPSFLRLGSWNVIMFVCFEQLKKELMKSRQ TVDCTT
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Mitochondrial protein responsible for thermogenic respiration, a specialized capacity of brown adipose tissue and beige fat that participates in non-shivering adaptive thermogenesis to temperature and diet variations and more generally to the regulation of energy balance. Functions as a long-chain fatty acid/LCFA and proton symporter, simultaneously transporting one LCFA and one proton through the inner mitochondrial membrane. However, LCFAs remaining associated with the transporter via their hydrophobic tails, it results in an apparent transport of protons activated by LCFAs. Thereby, dissipates the mitochondrial proton gradient and converts the energy of substrate oxydation into heat instead of ATP. Regulates the production of reactive oxygen species/ROS by mitochondria.
Gene References into Functions
The expression of peroxisome proliferator-activated receptor gamma coactivator 1alpha (PGC-1alpha) and uncoupling protein (UCP)-1 in brown adipocytes.PMID:27686967
e found that CPT1AM-expressing rBA have increased FAO, lipolysis, UCP1 protein levels and mitochondrial activity. Additionally, enhanced FAO reduced the palmitate-induced increase in triglyceride content and the expression of obese and inflammatory markers. Thus, CPT1AM-expressing rBA had enhanced fat-burning capacity and improved lipid-induced derangements.PMID:27438137
The history of discovery of UCP1, the mitochondrial uncoupling protein of brown adipocyte, has been described. (Review)PMID:27916641
In the absence of regulators (fatty acids, retinoids), rodent UCP1 presents a high ohmic proton conductance that cannot be detected in human UCP1.PMID:27750036
Data indicate that prolonged cold exposure may induce anti-inflammatory response in mesenteric white adipose tissue associated with induction of UCP-1 expression.PMID:27560796
results suggest that modulation of serotonin system results in positive modulation of UCP and mitochondrial bioenergetics in brown fat tissue.PMID:26129910
Data suggest that expression of Ucp1 in brown adipose tissue (BAT) of fetal/neonatal pups is regulated by maternal dietary factors; here, maternal low-protein diet up-regulates expression of Ucp1 and reduces birth weight of obesity-prone male pups.PMID:25858881
Vitamin D deficiency decreases adiposity in rats and causes altered expression of uncoupling proteins and steroid receptor coactivator3PMID:25132457
An ERRgamma inverse agonist reduces UCP1 expression in brown adipocytes.PMID:23404793
there is a role for ubiquitinylation and the cytosolic proteasome in turnover of mitochondrial UCP1.PMID:22531154
Data suggest that interscapular brown adipose tissue plays important role in burn injury-induced hypermetabolism through its morphological changes and expression of Ucp1.PMID:23169784
Endurance training blocked the high-sugar diet induced up-regulation of UCP1 expression in interscapular brown adipose tissue, whereas it up-regulated the expression of Ucp3 mRNA in muscle.PMID:23084644
Fatty acids and nucleotides compete to regulate the activity of UCP1.PMID:22952235
Production of UCP1 a membrane protein from the inner mitochondrial membrane using the cell free expression system in the presence of a fluorinated surfactant.PMID:22226924
We observed that stressed rats increased the expression of UCP-1 in the mitochondria and PPAR-gamma.PMID:20948513
the mammalian thermogenic mitochondrial protein; found in brown adipocytesPMID:11748291
energy metabolism and expression of uncoupling protein 1 in brown adipose tissue after 21 days of recovery from intracerebroventricular mouse leptin in ratsPMID:12062312
UCP1 muscle gene transfer is associated with an induced mitochondrial proton leak, which could contribute to increase energy expenditure.PMID:12127082
High levels are expresssed in muscle of transgenic mice and selective affect muscles at rest and decreases their IIb fiber contentPMID:12221093
Data show that rosiglitazone or retinoid treatment activates p38 MAP kinase, which is involved in uncoupling protein-1 (UCP-1) gene expression in fetal rat brown adipocytes.PMID:12414803
Substitutional mutations in the uncoupling protein-specific sequences of UCP1 revealed amino acid residues of the first alpha-helix UCP signature may be required to hold the intact UCP1 transport conformationPMID:12479871
Effects of dietary protein content on uncoupling proteins (UCP) 1, 2 and 3 expression in various tissues of Zucker lean and obese rats were studiedPMID:12603007
Model where the nucleotide binds deep inside the bundle core. The purine ring interacts with the matrix loops while the polyphosphate chain is stabilized through interactions with essential Arg residues.PMID:12678439
Results suggest that ventromedial hypothalamic lesions enhance expression of uncoupling proteins 1, 2, and 3 in brown adipose tissue under long-term fasting through an increase in peroxisome proliferator-activated receptor-gamma activity.PMID:12706490
study of isolation, refolding, transport properties, and regulation of recombinant UCP1PMID:12734183
Independent caudal brainstem Mc3r/Mc4r trigger for sympathetically stimulated elevation in brown adipose tissue UCP-1 gene expression. Melanotan-II induced rise in UCP-1 expression can be mediated by caudal brainstem and spinal cord.PMID:12960080
UCP1 expression was significantly increased in repeated immobilized group. UCP1 gene expression significantly increased, and acute immobilization induced further increase.PMID:14529581
results suggest that the inhibition of leptin secretion during lactation is involved in the down-regulation of uncoupling protein 1 and 3 expression in brown adipose tissue and skeletal musclePMID:14605003
Alpha-helices are the major component of UCP1 secondary structure. PN-binding mechanism does not involve significant secondary-structure rearrangement. UCP1 shares similar secondary-structure characteristics with the ADP/ATP carrier.PMID:14766012
Infusion of histamine into the third cerebral ventricle of rats increased the activity of sympathetic nerves and UCP1 mRNA expression in brown adipose tissue.PMID:15099666
Transgenic mice expressing rat UCP1 show low UCP1 activity under normoxia but is induced during ischemia-reperfusion. The presence of UCP1 mitigates reperfusion-induced damage, probably because it lowers mitochondrial hyperpolarization at reperfusion.PMID:15262832
has the capacity to regulate metabolic flux and production of reactive oxygen-containing molecules in the thymus.PMID:15695816
UCP-1, Mc4R and CART gene expression are increased as an immediate consequence of consuming high energy diet, and may be involved in countering hypercaloric intake.PMID:15720470
The decline in leptin is consistent with the hyperphagic response, and we conclude that one of the mediators of elevated metabolism during prolonged REM-SD is increased gene expression of UCP1 in BAT.PMID:15727948
UCP1 content in rat brown fat is notably affected by changed thyroid status.PMID:15891081
This result indicates that fucoxanthin upregulates the expression of UCP1 in WAT, which may contribute to reducing WAT weight.PMID:15896707
the mechanism of action of UCP 1 is to filp long-chain fatty acid anionsPMID:16291746
reactive alkenals activate the proton conductance of UCP1 more strongly when fatty acids are also added, with implications for both mechanistic and physiological models of UCP1 activationPMID:16451125
Protein chimeras where different regions of the second repeat of UCP1 have been sequentially replaced with their UCP2 counterparts were generated. These chimeras present a progressive degradation of the characteristic bioenergetic properties of UCP1.PMID:16814247
These data suggested that TUSC5 is involved in the differentiation, and its expression is regulated independently of the beta-adrenergic pathway in BAT.PMID:17592729
These findings suggest that mitochondrial UCPs could play both a neuro-protective role against oxidative damage and a thermal signaling role for neuro-modulation in vestibular nerve.PMID:17686539
Benidipine up-regulates not only UCP1 gene expression in BAT but also UCP3 gene expression in BAT and gastrocnemius muscle, which may contribute to thermogenesis in rats.PMID:17878603
The changes observed in BAT suggest that IL-15 could be implicated in lipid consumption in this tissue by regulating lipid oxidation and probably thermogenesis, processes mediated by UCP1 and UCP3 and PPARdelta and PPARalpha.PMID:18239634
UCP 1 is present in rat and mouse thymocytes and the antibody to full-length UCP 1 is not specific for UCP 1.PMID:18471433
UCP1 mRNA expression is upregulated by tea catechins, and the suppressive effect of catechins on body fat is associated with UCP1 expression in brown fat.PMID:18479902
Data demonstrate that, in pancreatic beta-cells, UCP1/2 have no uncoupling activity in the basal state or after fatty acid stimulation.PMID:18626658
UCP-2 is the only isoform detectable in the kidney and UCP-2 protein can be detected in proximal tubular cells and cells of the medullary thick ascending loop of HenlePMID:19227473
demonstrate that activation of UCP1 leads to a purine nucleotide-sensitive decrease in the ubiquinone redox state.PMID:19747168