Recombinant Rat Leukotriene B4 receptor 1 (Ltb4r)

Code: CSB-CF886424RA

Rate （N/A）
Review （0）

Size:

20μg100μg

US$5121

Quantity:

Express system: in vitro E.coli expression system

Species: Rattus norvegicus (Rat)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

Ltb4r

Uniprot NO.

Q9R0Q2

Alternative Names

Ltb4r; Blt; Leukotriene B4 receptor 1; LTB4-R 1; LTB4-R1

Species

Rattus norvegicus (Rat)

Source

in vitro E.coli expression system

Expression Region

1-351

Target Protein Sequence

MAANTTSTAATSSPGGMSLSLLPIVLLSVALVVGLPGNSFVVWSILKRMQKRSVTALLVL NLALADLAVLLTAPFFLHFLARGTWSFEVTGCRLCHYVCGVSMYASVLLITIMSLDRSLA VARPFVSQKVRTKAFARWVLAGIWVVSFLLAIPVLVYRTVTPKNKTLICDSRYPSDGHKV FHLLFEAITGFLLPFLAVVASYSDIGRRLQARRFRRSRRTGRLVVLIILAFAAFWLPYHL VNLVEAGRTLAGWDKNSPAGQRLKLARYVLIALAFLSSSVNPVLYACAGGGLLRSAGVGF VVKLLEGTGSEVSSTRRGGTLVQTPKATPTCPEPGPTDSFMTSSTPPESSK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Receptor for leukotriene B4, a potent chemoattractant involved in inflammation and immune response.

Gene References into Functions

Study verified that both BLT1 mRNA and BLT1 protein expressions were markedly increased after subarachnoid hemorrhage and elevated BLT1 expressions were mainly found in neurons, microglia and endothelial cells rather than astrocytes. We also demonstrated that there a significant positive correlation between BLT1 and nuclear p65 protein expressions in the same specific time course. PMID:27725151
BLT1 and BLT2 were involved in synovial cell proliferation. PMID:21189570
LTB4 down-regulates airway contraction and inflammation through activation of the hypothalamic-pituitary-adrenal axis via its BLT1 receptor. PMID:20403205
The time-dependent expression of Ltb4r in experimental arthritis was studied. PMID:17481560
FcgammaRI ligation leads to a complex with BLT1 in lipid rafts that enhances rat lung macrophage antimicrobial functions. PMID:19657115