Home
Product
Protein
Transmembrane Proteins
Recombinant Rat Leukocyte surface antigen CD47 (Cd47)

Recombinant Rat Leukocyte surface antigen CD47 (Cd47)

Code: CSB-CF004940RA

Rate （N/A）
Review （0）

Size:

20μg100μg

US$4627

Quantity:

Express system: in vitro E.coli expression system

Species: Rattus norvegicus (Rat)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

Cd47

Uniprot NO.

P97829

Alternative Names

Cd47; Leukocyte surface antigen CD47; Integrin-associated protein; IAP; CD antigen CD47

Species

Rattus norvegicus (Rat)

Source

in vitro E.coli expression system

Expression Region

19-303

Target Protein Sequence

QLLLSKVKSVEFTSCNDTVVIPCKVLNVEAQSTDEMFVKWKLNKSYIFIYDGNKNSTTRE QNFTSAKISVSDLLKGIASLTMDTHEAVVGNYTCEVTELSREGKTVIELKNRPVSWFSTN EKILIVIFPILAILLFWGKFGILTLKYKSSHTNKRIILLLVAGLALTLIVVVGAILFIPG EKPVKNASGLGLIVISTGILILLQYNVFMTAFGMTSFTIAILITQVLGYVLAVVGMCLCI MACEPVHGPLLISGLGIIALAELLGLVYMKFVASNQRTIQPPRNN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Has a role in both cell adhesion by acting as an adhesion receptor for THBS1 on platelets, and in the modulation of integrins. Receptor for SIRPA, binding to which prevents maturation of immature dendritic cells and inhibits cytokine production by mature dendritic cells. Interaction with SIRPG mediates cell-cell adhesion, enhances superantigen-dependent T-cell-mediated proliferation and costimulates T-cell activation. May play a role in membrane transport and/or integrin dependent signal transduction. May prevent premature elimination of red blood cells. May be involved in membrane permeability changes induced following virus infection. Plays an important role in memory formation and synaptic plasticity in the hippocampus.

Gene References into Functions

down-regulation of CD47 exerts a protective effect against myocardial I/R injury, which may be attributable to attenuation of oxidative stress via activation of the eNOS/nitric oxide signaling pathway. PMID:27960187
CD47 blockade with CD47mAb400 administered both to the donor and the recipient reduced liver graft ischemia reperfusion injury in a rat liver transplantation model. PMID:25482981
IAP2 overexpression in neural stem cells induced neuronal differentiation. PMID:25706387
The CD47-binding peptide of thrombospondin-1 induces defenestration of liver sinusoidal endothelial cells. PMID:23799952
These data reveal a novel role for CD47-mediated signaling in the control of the molecular network governing endothelial-dependent T-cell diapedesis. PMID:23990210
genetic induction of the expression of recipient CD47 on xenogeneic donor cells could provide inhibitory signals to recipient macrophages via SIPRalpha PMID:23472187
Thrombospondin-1 regulates blood flow via CD47 receptor-mediated activation of NADPH oxidase 1. PMID:23087362
Data suggest that hyperglycemia induces increase in association of IAP with SHPS-1 (tyrosine phosphatase non-receptor type substrate-1); this appears to be a generalized response of endothelial cells that contributes to endothelial cell dysfunction. PMID:22193512
IAP plays important roles in dendritic outgrowth and synaptic transmission in developing cortical neurons through the activation of MAPK PMID:15297459
4N1K-stimulated mast cell exocytosis involves a CD47/integrin/G(i) protein complex. PMID:19205621
Amyloid beta peptides trigger CD47-dependent mast cell secretory and phagocytic responses. PMID:19505377