Lair1; Leukocyte-associated immunoglobulin-like receptor 1; LAIR-1; rLAIR1; CD antigen CD305
Species
Rattus norvegicus (Rat)
Source
in vitro E.coli expression system
Expression Region
22-263
Target Protein Sequence
QEESLSDFTICAEPGPVIPQGNFITIVCSTSGEYDTVRLEKEGSTFMEKKTEPHGKQHRF RIGPVNETITGYYNCIFEKNYVWSQRSNDLQLKVIKENVTQGLAPGPSMTSDTSWLKTYS IHILTVVSVIFLLCLSLFLFCFLSHRQKKQGLPNNKSQHQRSQERLNLATNGLEKTSDIV MDDSLSEDRQTETWTPVAGDLQEVTYAQLDHDSLTQRTVKDVTPQNRVIMAESSTYAAIM RC
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Functions as an inhibitory receptor that plays a constitutive negative regulatory role on cytolytic function of natural killer (NK) cells, B-cells and T-cells. Activation by Tyr phosphorylation results in recruitment and activation of the phosphatases PTPN6 and PTPN11. It also reduces the increase of intracellular calcium evoked by B-cell receptor ligation. May also play its inhibitory role independently of SH2-containing phosphatases. Modulates cytokine production in CD4+ T-cells, down-regulating IL2 and IFNG production while inducing secretion of transforming growth factor beta. Down-regulates also IgG and IgE production in B-cells as well as IL8, IL10 and TNF secretion. Inhibits proliferation and induces apoptosis in myeloid leukemia cell lines as well as prevents nuclear translocation of NF-kappa-B p65 subunit/RELA and phosphorylation of I-kappa-B alpha/CHUK in these cells. Inhibits the differentiation of peripheral blood precursors towards dendritic cells.