QEICRNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVTHLSVSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVACMEENAPKNVKESLKKPETRNFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKAAKSPEDPGLQWTAMALPALISLVIGFAFGALYWKKKQSSLTRAVENIQINEEDNEISMLQQKEREFQEV
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Ligand for the receptor-type protein-tyrosine kinase KIT. Plays an essential role in the regulation of cell survival and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration and function, and in melanogenesis. KITLG/SCF binding can activate several signaling pathways. Promotes phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase, and subsequent activation of the kinase AKT1. KITLG/SCF and KIT also transmit signals via GRB2 and activation of RAS, RAF1 and the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1. KITLG/SCF and KIT promote activation of STAT family members STAT1, STAT3 and STAT5. KITLG/SCF and KIT promote activation of PLCG1, leading to the production of the cellular signaling molecules diacylglycerol and inositol 1,4,5-trisphosphate. KITLG/SCF acts synergistically with other cytokines, probably interleukins.
Gene References into Functions
the SCF/c-KIT system is aberrantly expressed in varicocele(VC) testis, which could be involved in male infertility caused by VC.PMID:27707610
It was concluded that the exposure of cadimium on newborn rats ovaries could inhibit follicle development. SCF/c-kit system might mediate follicle development damage caused by cadmium, which is associated with DNA hypomethylation of SCF/c-kit promoter region may be worthy of further study.PMID:28801138
up-regulation of the NPs/NPR-C and NPs/NPR-A, B/cGMP signaling pathways may be involved in depression-induced loss of gastric ICC by decreasing the production of mSCFPMID:26862759
Downregulation of either c-kit or CXCR4 in bone marrow stem cells decreased engraftment of circulating bone marrow stem cells and inhibited reparative effects of transmyocardial revascularization.PMID:25420576
A 100 nM dose of E2 unbalanced the SCF/c-kit system, with a crucial impact on germ cell survival and thus male fertility.PMID:24825426
SCF/c-kit signaling pathway is required for maintenance of interstitial cells of Cajal phenotype, survival, proliferation, and differentiation.PMID:24228598
In diabetic colonic dysmotility, deficiency of endogenous IGF-1 in colonic smooth muscle cells leads to reduction of SCF expression.PMID:23745035
The results of this study concluded that Electroacupuncture treatment up-regulates the positive cells and mRNA expression of SCF after cerebral ischemia/reperfusion.PMID:22526758
These results suggest that overload training inhibits the phagocytosis and the ROS generation of peritoneal macrophages, and that MGF produced by macrophages may play a key role in this process.PMID:22592456
activated mature cardiac mast cells are responsible, in a paracrine fashion, for the increase in mature mast cell density post aortocaval fistula by rapidly increasing SCF levels via the release of chymase.PMID:22850284
Stem cell factor gene transfer induces c-kit(+) stem/progenitor cell expansion in situ and cardiomyocyte proliferation, which may represent a new therapeutic strategy to reverse adverse remodeling after myocardial infarction.PMID:22931954
results indicate that KL-c-kit interaction plays a role in estrogenic regulation through oocyte-granulosa cell communicationPMID:22366471
Expression of SCF+GM-CSF after hepatectomy can contribute to biliary remodeling (e.g., post-transplantation) by functional deregulation of the activity of key signaling intermediates involved in cell expansion and multipotent differentiation.PMID:21932404
SCF expression in gastric smooth muscle cells is stimulated by IGF-1 in both dose- and time-dependent manners through IGF-1R in which ERKMAPK signal transduction may play an important role.PMID:21092510
ability of ghrelin to modulate the expression of the SCF genePMID:15284210
SCF released from astrocytes directs neural progenitor cell migration under hypoxic conditions.PMID:17581219
SCF and its receptor may play a role in the remodelling process of serum nephrotoxic nephritis.PMID:18087173
Stem cell factor/c-kit signaling mediated cardiac stem cell migration via activation of p38 MAPK.PMID:18087667
4-vinylcyclohexene diepoxide compromises KIT/KITL signaling, which is critical for follicular survival in primordial and primary follicles.PMID:18448842
fetal exposures to DEHP have effects on FLC number, distribution, and most importantly, steroidogenic capacity and abnormal expressions of IGF1, KITL, and LIF genes may contribute to the reproductive toxicity of phthalatesPMID:18469139
Follicle stimulating hormone has a protective effect on germ cells after unilateral testicular torsion, which is reflected by increased SCF expression.PMID:18544282
postsynaptic RapGAP SPAR is regulated by Polo-like kinase 2 and the SCFbeta-TRCP ubiquitin ligase in hippocampal neuronsPMID:18723513
Upregulation of stem cell factor and c-kit expression occured after spinal cord injury. Stem cell factor could be useful as an agent for treatment of spinal cord injury.PMID:19182706
mRNA upregulated up to 20-fold in intrahepatic cholangiocarcinomaPMID:19255573
Show
More
Hide
All
Subcellular Location
[Isoform 1]: Cell membrane; Single-pass type I membrane protein.; [Isoform 2]: Cytoplasm. Cytoplasm, cytoskeleton. Cell membrane; Single-pass type I membrane protein. Cell projection, lamellipodium. Cell projection, filopodium.; [Soluble KIT ligand]: Secreted.