Recombinant Rat Kit ligand (Kitlg)

Code: CSB-CF012376RA

Rate （N/A）
Review （0）

Size:

20μg100μg

US$4350

Quantity:

Express system: in vitro E.coli expression system

Species: Rattus norvegicus (Rat)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

Kitlg

Uniprot NO.

P21581

Species

Rattus norvegicus (Rat)

Source

in vitro E.coli expression system

Expression Region

26-273

Target Protein Sequence

QEICRNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVTHLSVSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVACMEENAPKNVKESLKKPETRNFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKAAKSPEDPGLQWTAMALPALISLVIGFAFGALYWKKKQSSLTRAVENIQINEEDNEISMLQQKEREFQEV
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Ligand for the receptor-type protein-tyrosine kinase KIT. Plays an essential role in the regulation of cell survival and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration and function, and in melanogenesis. KITLG/SCF binding can activate several signaling pathways. Promotes phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase, and subsequent activation of the kinase AKT1. KITLG/SCF and KIT also transmit signals via GRB2 and activation of RAS, RAF1 and the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1. KITLG/SCF and KIT promote activation of STAT family members STAT1, STAT3 and STAT5. KITLG/SCF and KIT promote activation of PLCG1, leading to the production of the cellular signaling molecules diacylglycerol and inositol 1,4,5-trisphosphate. KITLG/SCF acts synergistically with other cytokines, probably interleukins.

Gene References into Functions

the SCF/c-KIT system is aberrantly expressed in varicocele(VC) testis, which could be involved in male infertility caused by VC. PMID:27707610
It was concluded that the exposure of cadimium on newborn rats ovaries could inhibit follicle development. SCF/c-kit system might mediate follicle development damage caused by cadmium, which is associated with DNA hypomethylation of SCF/c-kit promoter region may be worthy of further study. PMID:28801138
up-regulation of the NPs/NPR-C and NPs/NPR-A, B/cGMP signaling pathways may be involved in depression-induced loss of gastric ICC by decreasing the production of mSCF PMID:26862759
Downregulation of either c-kit or CXCR4 in bone marrow stem cells decreased engraftment of circulating bone marrow stem cells and inhibited reparative effects of transmyocardial revascularization. PMID:25420576
A 100 nM dose of E2 unbalanced the SCF/c-kit system, with a crucial impact on germ cell survival and thus male fertility. PMID:24825426
SCF/c-kit signaling pathway is required for maintenance of interstitial cells of Cajal phenotype, survival, proliferation, and differentiation. PMID:24228598
In diabetic colonic dysmotility, deficiency of endogenous IGF-1 in colonic smooth muscle cells leads to reduction of SCF expression. PMID:23745035
The results of this study concluded that Electroacupuncture treatment up-regulates the positive cells and mRNA expression of SCF after cerebral ischemia/reperfusion. PMID:22526758
These results suggest that overload training inhibits the phagocytosis and the ROS generation of peritoneal macrophages, and that MGF produced by macrophages may play a key role in this process. PMID:22592456
activated mature cardiac mast cells are responsible, in a paracrine fashion, for the increase in mature mast cell density post aortocaval fistula by rapidly increasing SCF levels via the release of chymase. PMID:22850284
Stem cell factor gene transfer induces c-kit(+) stem/progenitor cell expansion in situ and cardiomyocyte proliferation, which may represent a new therapeutic strategy to reverse adverse remodeling after myocardial infarction. PMID:22931954
results indicate that KL-c-kit interaction plays a role in estrogenic regulation through oocyte-granulosa cell communication PMID:22366471
Expression of SCF+GM-CSF after hepatectomy can contribute to biliary remodeling (e.g., post-transplantation) by functional deregulation of the activity of key signaling intermediates involved in cell expansion and multipotent differentiation. PMID:21932404
SCF expression in gastric smooth muscle cells is stimulated by IGF-1 in both dose- and time-dependent manners through IGF-1R in which ERKMAPK signal transduction may play an important role. PMID:21092510
ability of ghrelin to modulate the expression of the SCF gene PMID:15284210
SCF released from astrocytes directs neural progenitor cell migration under hypoxic conditions. PMID:17581219
SCF and its receptor may play a role in the remodelling process of serum nephrotoxic nephritis. PMID:18087173
Stem cell factor/c-kit signaling mediated cardiac stem cell migration via activation of p38 MAPK. PMID:18087667
4-vinylcyclohexene diepoxide compromises KIT/KITL signaling, which is critical for follicular survival in primordial and primary follicles. PMID:18448842
fetal exposures to DEHP have effects on FLC number, distribution, and most importantly, steroidogenic capacity and abnormal expressions of IGF1, KITL, and LIF genes may contribute to the reproductive toxicity of phthalates PMID:18469139
Follicle stimulating hormone has a protective effect on germ cells after unilateral testicular torsion, which is reflected by increased SCF expression. PMID:18544282
postsynaptic RapGAP SPAR is regulated by Polo-like kinase 2 and the SCFbeta-TRCP ubiquitin ligase in hippocampal neurons PMID:18723513
Upregulation of stem cell factor and c-kit expression occured after spinal cord injury. Stem cell factor could be useful as an agent for treatment of spinal cord injury. PMID:19182706
mRNA upregulated up to 20-fold in intrahepatic cholangiocarcinoma PMID:19255573

Hide All

Subcellular Location

[Isoform 1]: Cell membrane; Single-pass type I membrane protein.; [Isoform 2]: Cytoplasm. Cytoplasm, cytoskeleton. Cell membrane; Single-pass type I membrane protein. Cell projection, lamellipodium. Cell projection, filopodium.; [Soluble KIT ligand]: Secreted.

Protein Families

SCF family

Database Links

UNIGENE: Rn.44216

KEGG: rno:60427

STRING: 10116.ENSRNOP00000008471

Promotions