Home
Product
Protein
Transmembrane Proteins
Recombinant Rat Interleukin-2 receptor subunit beta (Il2rb)

Recombinant Rat Interleukin-2 receptor subunit beta (Il2rb)

Code: CSB-CF011650RA

Rate （N/A）
Review （0）

Size:

20μg100μg

US$6318

Quantity:

Express system: in vitro E.coli expression system

Species: Rattus norvegicus (Rat)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

Il2rb

Uniprot NO.

P26896

Species

Rattus norvegicus (Rat)

Source

in vitro E.coli expression system

Expression Region

27-537

Target Protein Sequence

AVNDCSHLKCFYNSRANVSCMWSPEEALNVTSCHIHAKSDMRHWNKTCELTPVRQASWACNLILGPLPDSQSLTSVDLLSLSVVCWEEKGWRRVKTCTFHPFDNLRLIAPHSLQVLHIETRRCNISWEVSQVSHYVNPYLEFEARRRLLDRSWEDASVFSLKQRQQWIFLETLTPDTSYELQVRVIAQRGKTRTWSPWSQPMAFRTRPADPKEIFPLPWLRCLLLVLGCFFGFLSCVCVLVKCRYLGPWLKTLLKCHIPDPSEFFSQLSSQHGGDLQKWLSSPVPQSFFSPTGSAPEISPLEVLDRDSKTMQMLLFQKEKASSPSPSGHSQASCFTNQGYFFFHLSNALEIESCQVYFTYDPCMEEDVEEDGPRLPEESPLPPLLPFTGEQDDYCAFPPRDDLLLFSPSMSTPNTAYGNSITPEERPPLSLQEGLPSLASPDLMGLQHPLELELGDDGEGMSTNSSGQQASVPEAALMGTTKTEARPVLTLNTDAYLSLQELQAQDSAHLI
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Receptor for interleukin-2. This beta subunit is involved in receptor mediated endocytosis and transduces the mitogenic signals of IL2. Probably in association with IL15RA, involved in the stimulation of neutrophil phagocytosis by IL15.

Subcellular Location

Cell membrane; Single-pass type I membrane protein. Cell surface.

Protein Families

Type I cytokine receptor family, Type 4 subfamily

Database Links

UNIGENE: Rn.5832

KEGG: rno:25746

STRING: 10116.ENSRNOP00000064699

Promotions