Recombinant Rat Integrin beta-4 (Itgb4), partial

Code: CSB-CF727354RAa2

Rate （N/A）
Review （0）

Size:

20ug100ug

US$878

Quantity:

Express system: in vitro E.coli expression system

Species: Rattus norvegicus (Rat)

Tag Info: N-terminal 6xHis-SUMO-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Abbreviation

Recombinant Rat Itgb4 protein, partial

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

Itgb4

Uniprot NO.

Q64632

Research Area

Signal Transduction

Species

Rattus norvegicus (Rat)

Source

in vitro E.coli expression system

Expression Region

28-713aa

Target Protein Sequence

SLTENVEEFWDKLQGERISGNLDAPEGGFDAILQTAVCTRDIGWRADSTHLLVFSTESAFHYEADGANVLAGIMNRNDEKCHLDATGAYTQYKTQDYPSVPTLVRLLAKHNIIPIFAVTNYSYSYYEKLHKYFPVSSLGVLQEDSSNIVELLEEAFYRIRSNLDIRALDSPRGLRTEVTSDTLQKTETGSFHIKRGEVGTYNVHLRAVEDIDGTHVCQLAKEDQRGNIHLKPSFSDGLRMDASVICDMCACELQKEVQSARCHYRGDFMCGHCVCNEGWSGKTCNCSTGSLSDTQPCLREGEDKPCSGHGECQCGRCVCYGEGRYEGHFCEYDNFQCPRTSGFLCNDRGRCSMGECVCEPGWTGRSCDCPLSNATCIDSNGGICNGLGFCECGRCHCNQRSSLYTDTTCEINYSAIRLGLCEDLRSCVQCQAWGTGEKKGRTCEECNFKVKMVDELKKAEEVVEYCSFRDEDDDCTYSYTVEGDGSPGPNSTVLVHKKKDCLPAPS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

92.2 kDa

Protein Length

Extracellular Domain

Tag Info

N-terminal 6xHis-SUMO-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Integrin alpha-6/beta-4 is a receptor for laminin. It plays a critical structural role in the hemidesmosome of epithelial cells. Is required for the regulation of keratinocyte polarity and motility. ITGA6:ITGB4 binds to NRG1 (via EGF domain) and this binding is essential for NRG1-ERBB signaling. ITGA6:ITGB4 binds to IGF1 and this binding is essential for IGF1 signaling. ITGA6:ITGB4 binds to IGF2 and this binding is essential for IGF2 signaling.

Gene References into Functions

this study suggests that downregulation of integrin beta4 is important for the development ozone stress-induced airway hyperresponsiveness, presumably because it causes increased oxidative damage and epithelial apoptosis. PMID:20510671
changes in transcription factor, c-Jun and krox-20, and integrin beta4 expression are temporally correlated with the process of demyelination, suggesting roles in regulating the myelin response to CNC injury PMID:19765400
the SDL segment of the beta4 integrin subunit is required for ligand binding and is involved in outside-in signaling PMID:12867433
During early stages of myelination, PMP22 and beta4 integrin are coexpressed at the DRG cell surface and can be coimmunoprecipitated together with laminin and alpha6 integrin. PMID:16436605