Recombinant Rat Histamine H2 receptor (Hrh2)

Code: CSB-CF010738RA

Rate （N/A）
Review （0）

Size:

20μg100μg

US$5173

Quantity:

Express system: in vitro E.coli expression system

Species: Rattus norvegicus (Rat)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

Hrh2

Uniprot NO.

P25102

Alternative Names

Hrh2; Histamine H2 receptor; H2R; HH2R; Gastric receptor I

Species

Rattus norvegicus (Rat)

Source

in vitro E.coli expression system

Expression Region

1-358

Target Protein Sequence

MEPNGTVHSCCLDSMALKVTISVVLTTLILITIAGNVVVCLAVSLNRRLRSLTNCFIVSL AATDLLLGLLVLPFSAIYQLSFTWSFGHVFCNIYTSLDVMLCTASILNLFMISLDRYCAV TDPLRYPVLVTPVRVAISLVFIWVISITLSFLSIHLGWNSRNGTRGGNDTFKCKVQVNEV YGLVDGLVTFYLPLLIMCVTYYRIFKIAREQAKRINHISSWKAATIREHKATVTLAAVMG AFIICWFPYFTAFVYRGLRGDDAINEAVEGIVLWLGYANSALNPILYAALNRDFRTAYQQ LFHCKFASHNSHKTSLRLNNSLLPRSQSREGRWQEEKPLKLQVWSGTELTHPQGNPIR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

The H2 subclass of histamine receptors mediates gastric acid secretion. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.

Gene References into Functions

the histaminergic afferent inputs in the striatum may modulate both dopamine D1 and D2 receptor-expressing medium spiny projection neurons by activation of postsynaptic histamine H1 and H2 receptors. PMID:29498008
findings indicate that histamine H1, H2, and H3 receptors are present in rat olfactory epithelium and may play a physiological role in olfactory transmission. PMID:28964277
Isolated rat mesenteric collecting lymphatics were treated with 1- to 100-muM histamine. Pharmacologic blockade of either H1 or H2 histamine receptors significantly inhibited the response to histamine. PMID:24702851
Na+-Ca2+ exchangers coupled to H1 receptors and hyperpolarization-activated cyclic nucleotide-gated channels linked to H2 receptors co-mediate the strong postsynaptic excitatory action of histamine on al vestibular nucleus neurons PMID:23713466
Histamine H2 receptors, unlike the H1 receptor type, do not mediate emotional memory consolidation impairment. PMID:22986235
Data suggest histamine stimulates proliferation of Leydig tumor cells via activation of HRH2 and a transient increase in intracellular cAMP levels. Normal/immature Leydig cells and progenitor Leydig cells exhibit very low levels of HDC expression. PMID:23077168
Data suggest that histamine facilitates consolidation of fear extinction through mechanism involving Hrh2-dependent phosphorylation of ERK1 in hippocampus. PMID:21211106
at the level of the hippocampus, histamine through its H1 and H2 receptors, mediates orofacial region pain PMID:21602597
H1, H2, and H3 histamine receptor mRNA detected in modiolus but not in lateral and medial portions of the cochlea. First evidence of H1, H2, and H3 histamine receptor mRNA in rat cochlea. PMID:12634496
Postischemic iecrease in H(2) receptor binding densities in the caudate-putamen. PMID:16181737
endogenous histamine might be involved in the recruitment of neutrophils and protein leaks in LPS-induced acute lung injury via the H2 receptors PMID:16858644
Data show that famotidine, a H2 receptor antagonist, decreases the late phase of orthodontic tooth movement in rats. PMID:18345502