Home
Product
Protein
Transmembrane Proteins
Recombinant Rat High affinity immunoglobulin epsilon receptor subunit gamma (Fcer1g)

Recombinant Rat High affinity immunoglobulin epsilon receptor subunit gamma (Fcer1g)

Code: CSB-CF008533RA

Rate （N/A）
Review （0）

Size:

20μg100μg

US$3219

Quantity:

Express system: in vitro E.coli expression system

Species: Rattus norvegicus (Rat)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

Fcer1g

Uniprot NO.

P20411

Alternative Names

Fcer1g; Fce1g; High affinity immunoglobulin epsilon receptor subunit gamma; Fc receptor gamma-chain; FcRgamma; Fc-epsilon RI-gamma; IgE Fc receptor subunit gamma; FceRI gamma

Species

Rattus norvegicus (Rat)

Source

in vitro E.coli expression system

Expression Region

19-86

Target Protein Sequence

LGEPQLCYILDAILFLYGIVLTLLYCRLKIQVRKADIASREKSDAVYTGLNTRNQETYETLKHEKPPQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Adapter protein containing an immunoreceptor tyrosine-based activation motif (ITAM) that transduces activation signals from various immunoreceptors. As a component of the high-affinity immunoglobulin E (IgE) receptor, mediates allergic inflammatory signaling in mast cells. As a constitutive component of interleukin-3 receptor complex, selectively mediates interleukin 4/IL4 production by basophils priming T-cells toward effector T-helper 2 subset. Associates with pattern recognition receptors CLEC4D and CLEC4E to form a functional signaling complex in myeloid cells. Binding of mycobacterial trehalose 6,6'-dimycolate (TDM) to this receptor complex leads to phosphorylation of ITAM, triggering activation of SYK, CARD9 and NF-kappa-B, consequently driving maturation of antigen-presenting cells and shaping antigen-specific priming of T-cells toward effector T-helper 1 and T-helper 17 cell subtypes. May function cooperatively with other activating receptors. Functionally linked to integrin beta-2/ITGB2-mediated neutrophil activation. Also involved in integrin alpha-2/ITGA2-mediated platelet activation.

Gene References into Functions

This study showed that CCL2, NF-kappaB1, RAC2, FCER1G and C1Q may contribute to the generation of neuropathic pain after sciatic nerve injury via immune and defense pathways. PMID:28033741
The results presented in this paper suggest that the Mincle/MCL/FcepsilonRI-gamma complex is the functionally optimal form for these C-type lectin receptors on the surface of myeloid cells. PMID:23921530
substitution of FcR-gamma T22 with non-polar amino acids does not interfere with surface expression of the FcvarepsilonRI and its signaling capacity PMID:22964482
Phospholipase D1 activity by regulating phosphatidic acid formation controls the early signals initiated by FcepsilonRI aggregation that lead to mast cell degranulation. PMID:15339843
Among the proteins that bind to phosphorylated beta ITAM of the FcepsilonRI-beta are Syk, Grb2, Shc, SHIP, and SHP-1, and binding does not depend on previous cell activation. PMID:17365510