ATQKSVVSLDPPWIRILTGDKVTLICNGNNSSQMNSTKWIHNDSISNVKSSHWVIVSATIQDSGKYICQKQGFYKSKPVYLNVMQEWLLLQSSADVVLDNGSFDIRCRSWKKWKVHKVIYYKDDIAFKYSYDSNNISIRKATFNDSGSYHCTGYLNKVECKSDKFSIAVVKDYTIEYRWLQLIFPSLAVILFAVDTGLWFSTHKQFESILKIQKTGKGKKKG
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Binds to the Fc region of immunoglobulins epsilon. High affinity receptor. Responsible for initiating the allergic response. Binding of allergen to receptor-bound IgE leads to cell activation and the release of mediators (such as histamine) responsible for the manifestations of allergy. The same receptor also induces the secretion of important lymphokines.
Gene References into Functions
Differential Ca(2+) mobilization and mast cell degranulation by FcepsilonRI- and GPCR-mediated signaling has been reported.PMID:29029788
This study reveals a complex regulation for PLSCR1 tyrosine phosphorylation in FcepsilonRI-activated mast cells, and that PLSCR1 sits at a crossroads between Lyn and Fyn pathways.PMID:25289695
Data suggest M2PK (M2-type pyruvate kinase) is modulated in mast cell degranulation via IgE/FCERI signaling; immediate inhibition of M2PK involves tyrosine phosphorylation; subsequently fructose-1,6-biphosphate accumulates and activates M2PK.PMID:24497038
PTP-PEST expression was significantly induced upon FcepsilonRI-crosslinking, and aggregation of FcepsilonRI induced the phosphorylation of PTP-PEST at Ser39, thus resulting in the suppression of PTP activity.PMID:24791697
NK-1 receptor is required for the activation of RBL-2H3 cells following FcepsilonRIota engagement and involved in the regulation of mitogen-activated protein kinase signaling pathwaysPMID:22820943
results reveal intricate functional interactions among different cis-acting elements of IgE receptor in the transcriptional regulation of cox-2. Fyn-->PI 3-kinase-->Akt pathway directly stimulatePMID:22613973
Data show that among expressed chemokines and cytokines, only CCL2, CCL7 and interleukin (IL)-6 were expressed at higher levels following FcepsilonRI-CCR1 costimulation.PMID:22417871
These data suggest that CD84 may play a role in modulating Fc epsilon RI-mediated signaling in mast cells.PMID:18243321
Data show that EGFR, via interaction with FcvarepsilonRI and integrin alpha(5), is necessary for allergic inflammation associated with cellular interaction.PMID:21349584
In an immunological model, although serial engagement is not required for rat mast cell signaling, it can influence recruitment of Syk kinase to the receptor and subsequent Syk phosphorylation.PMID:20733205
The spatiotemporal dynamics of the redistribution of immunoglobulin E-loaded receptors (IgE-FcepsilonRI) on rat basophilic leukemia-2H3 mast cells, was quatified.PMID:20643056
Mast cells produce intercellular connections and that mediators are directionally released upon co-stimulation of FcepsilonRI and CCR1.PMID:20173038
pineal Fcer1a mRNA levels are controlled by a well described neural pathwayPMID:17728245
Glycosylated FcepsilonRI alpha chain is required for activation of mast cells for IL-4 production by M. pneumoniae.PMID:18042342
Ca(2+) signaling pathway via a sphingosine kinase (SK) is dependent on clathrin.PMID:18675457
Show
More
Hide
All
Subcellular Location
[Isoform 1]: Cell membrane; Single-pass type I membrane protein.; [Isoform 2]: Secreted.
Tissue Specificity
Expressed in leukocytes and pinealocytes at night (at protein level).