MANNASLEQDQNHCSAINNSIPLTQGKLPTLTLSGKIRVTVTFFLFLLSTAFNASFLVKL QRWTQKRKKGKKLSRMKVLLKHLTLANLLETLIVMPLDGMWNITVQWYAGEFLCKVLSYL KLFSMYAPAFMMVVISLDRSLAVTQPLAVQSKSKLERSMTSLAWILSIVFAGPQLYIFRM IYLADGSGPAVFSQCVTHCSFPQWWHEAFYNFFTFSCLFIIPLLIMLICNAKIIFALTRV LHQDPRKLQLNQSKNNIPRARLRTLKMTVAFGTSFVICWTPYYVLGIWYWFDPEMLNRVS EPVNHFFFLFAFLNPCFDPLIYGYFSL
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Receptor for gonadotropin releasing hormone (GnRH) that mediates the action of GnRH to stimulate the secretion of the gonadotropic hormones luteinizing hormone (LH) and follicle-stimulating hormone (FSH). This receptor mediates its action by association with G-proteins that activate a phosphatidylinositol-calcium second messenger system.
Gene References into Functions
the age-dependent basal and regulated Gnrhr transcription could account for the initial blockade and subsequent activation of the reproductive system during development.PMID:27569529
Prevention of estradiol synthesis blocked the ability of peripheral estradiol administration in ovariectomized rats to enhance hippocampus-dependent memory in a radial-maze task. Hippocampal GnRH receptor antagonism blocked the ability of peripheral estradiol administration in ovariectomized rats to enhance hippocampus-dependent memory.PMID:28032117
GnRH-R is expressed in the mammary tissues after weaning; GnRH is involved in the involution and tissue remodeling of post-lactating rat mammary tissuesPMID:27349532
Gnrhr promoter sequences are mainly responsible for directing transcriptional programmes and play a predominant role over the species-specific cell environment.PMID:25556311
Data indicate that GnRH-R expression is strongest in the hippocampus of adult female rats.PMID:23906992
Rather than using alternate promoters, Gnrhr expression is directed to diverse cell lineages through specific associations of transcription factors acting on distinct response elements along the same promoter.PMID:22414758
SET protein interacts with intracellular domains of the gonadotropin-releasing hormone receptor and differentially regulates receptor signaling to cAMP and calcium in gonadotrope cellsPMID:23233674
Data demonstrate herein that the onset of GnRHR gene (Gnrhr) expression in the rat hippocampus was unexpectedly delayed as compared to the pituitary and only occurred after birth.PMID:21123436
Low-level GnRHR expression in the ovaries of rats with cyclophosphamide exposure suggest microenvironment disturbances in the damaged rat ovaries in advanced stage of chemotherapy.PMID:18024297
Localization of a functional GHRH-R in Henle's loop and its regulation during development and aging suggest roles associated with cellular proliferation, differentiation, and/or water/electrolyte transportPMID:11897706
Data show that removal of all three carboxyl terminal residues or mutation of the gonadotropin-releasing hormone receptor at Phe(325) caused a complete loss of measurable ligand binding and effector coupling, clearly suggesting a role for Phe(325).PMID:11997175
results indicate that the GnRH receptor activates both G(q) and G(s) signaling to regulate gene expression in L beta T2 cellsPMID:12050161
role of the GnRHR carboxyl-terminus in the regulation of the GnRHR by RGS (regulators of G protein signaling) proteinsPMID:12062898
The distribution of androgen receptor and its coexistence with gonadotropin releasing hormone receptor in rat submaxillary glandsPMID:12479044
GnRH receptor immunoreactive materials were colocalized in the epithelial cells of the serous acinus and glandular duct of the submaxillary glandPMID:12697272
Position of Pro and Ser near Glu7.32 in the extracellular loop 3 is critical for the differential ligand selectivity between mammalian and nonmammalian GnRHRs.PMID:14525953
direct role for the GnRHR in mediating antiproliferative events in two cell systems, neither of which was derived from extrapituitary reproductive tumors.PMID:14551223
Developmental GnRH-R and gonadotropin beta subunit gene expression is almost entirely GnRH dependent, not only in the juvenile prepubertal stage but also during the infantile period.PMID:14561652
GnRH receptor can be expressed by gastric smooth muscle cells of rats.PMID:15188505
the HFRK motif in the membrane-proximal region confers the differential signal transduction pathways between mammalian and nonmammalian GnRHRsPMID:15563546
there are species-specific dominant negative receptor trafficking effects of the GnRHR between human, rat and mousePMID:15886197
GnRH-R mRNA in the pituitary and hypothalamus of long-term ovariectomized (OVX) rats, at different times of day.PMID:16672174
proportion of the human and the rat WT GnRHR appears to be retained in the endoplasmic reticulum by calnexin, an effect that decreases GnRHR signaling capacityPMID:17170088
These results, for the first time, support the transcription of GnRHR mRNA and its translation to protein in the rat oviduct throughout the postimplantation period of pregnancy.PMID:17875654
Results indicate that the residues flanking Glu(7.32) of the mammalian type-I gonadotropin-releasing hormone receptor are important for antagonist as well as agonist selectivity.PMID:18319619
Both cultured spinal cord neurons of rat embryos and adult rats expressed the GnRH receptor mRNA. GnRH may play other roles independently from its participation in reproductive function.PMID:19539704