Recombinant Rat Gonadotropin-releasing hormone receptor (Gnrhr)

Code: CSB-CF009637RA
Size:
20μg
20μg100μg
US$4941
Quantity:
Express system: in vitro E.coli expression system
Species: Rattus norvegicus (Rat)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
Gnrhr
Uniprot NO.
Alternative Names
Gnrhr; Gonadotropin-releasing hormone receptor; GnRH receptor; GnRH-R
Species
Rattus norvegicus (Rat)
Source
in vitro E.coli expression system
Expression Region
1-327
Target Protein Sequence
MANNASLEQDQNHCSAINNSIPLTQGKLPTLTLSGKIRVTVTFFLFLLSTAFNASFLVKL QRWTQKRKKGKKLSRMKVLLKHLTLANLLETLIVMPLDGMWNITVQWYAGEFLCKVLSYL KLFSMYAPAFMMVVISLDRSLAVTQPLAVQSKSKLERSMTSLAWILSIVFAGPQLYIFRM IYLADGSGPAVFSQCVTHCSFPQWWHEAFYNFFTFSCLFIIPLLIMLICNAKIIFALTRV LHQDPRKLQLNQSKNNIPRARLRTLKMTVAFGTSFVICWTPYYVLGIWYWFDPEMLNRVS EPVNHFFFLFAFLNPCFDPLIYGYFSL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Receptor for gonadotropin releasing hormone (GnRH) that mediates the action of GnRH to stimulate the secretion of the gonadotropic hormones luteinizing hormone (LH) and follicle-stimulating hormone (FSH). This receptor mediates its action by association with G-proteins that activate a phosphatidylinositol-calcium second messenger system.
Gene References into Functions
  1. the age-dependent basal and regulated Gnrhr transcription could account for the initial blockade and subsequent activation of the reproductive system during development. PMID:27569529
  2. Prevention of estradiol synthesis blocked the ability of peripheral estradiol administration in ovariectomized rats to enhance hippocampus-dependent memory in a radial-maze task. Hippocampal GnRH receptor antagonism blocked the ability of peripheral estradiol administration in ovariectomized rats to enhance hippocampus-dependent memory. PMID:28032117
  3. GnRH-R is expressed in the mammary tissues after weaning; GnRH is involved in the involution and tissue remodeling of post-lactating rat mammary tissues PMID:27349532
  4. Gnrhr promoter sequences are mainly responsible for directing transcriptional programmes and play a predominant role over the species-specific cell environment. PMID:25556311
  5. Data indicate that GnRH-R expression is strongest in the hippocampus of adult female rats. PMID:23906992
  6. Rather than using alternate promoters, Gnrhr expression is directed to diverse cell lineages through specific associations of transcription factors acting on distinct response elements along the same promoter. PMID:22414758
  7. SET protein interacts with intracellular domains of the gonadotropin-releasing hormone receptor and differentially regulates receptor signaling to cAMP and calcium in gonadotrope cells PMID:23233674
  8. Data demonstrate herein that the onset of GnRHR gene (Gnrhr) expression in the rat hippocampus was unexpectedly delayed as compared to the pituitary and only occurred after birth. PMID:21123436
  9. Low-level GnRHR expression in the ovaries of rats with cyclophosphamide exposure suggest microenvironment disturbances in the damaged rat ovaries in advanced stage of chemotherapy. PMID:18024297
  10. Localization of a functional GHRH-R in Henle's loop and its regulation during development and aging suggest roles associated with cellular proliferation, differentiation, and/or water/electrolyte transport PMID:11897706
  11. Data show that removal of all three carboxyl terminal residues or mutation of the gonadotropin-releasing hormone receptor at Phe(325) caused a complete loss of measurable ligand binding and effector coupling, clearly suggesting a role for Phe(325). PMID:11997175
  12. results indicate that the GnRH receptor activates both G(q) and G(s) signaling to regulate gene expression in L beta T2 cells PMID:12050161
  13. role of the GnRHR carboxyl-terminus in the regulation of the GnRHR by RGS (regulators of G protein signaling) proteins PMID:12062898
  14. The distribution of androgen receptor and its coexistence with gonadotropin releasing hormone receptor in rat submaxillary glands PMID:12479044
  15. GnRH receptor immunoreactive materials were colocalized in the epithelial cells of the serous acinus and glandular duct of the submaxillary gland PMID:12697272
  16. Position of Pro and Ser near Glu7.32 in the extracellular loop 3 is critical for the differential ligand selectivity between mammalian and nonmammalian GnRHRs. PMID:14525953
  17. direct role for the GnRHR in mediating antiproliferative events in two cell systems, neither of which was derived from extrapituitary reproductive tumors. PMID:14551223
  18. Developmental GnRH-R and gonadotropin beta subunit gene expression is almost entirely GnRH dependent, not only in the juvenile prepubertal stage but also during the infantile period. PMID:14561652
  19. GnRH receptor can be expressed by gastric smooth muscle cells of rats. PMID:15188505
  20. the HFRK motif in the membrane-proximal region confers the differential signal transduction pathways between mammalian and nonmammalian GnRHRs PMID:15563546
  21. there are species-specific dominant negative receptor trafficking effects of the GnRHR between human, rat and mouse PMID:15886197
  22. GnRH-R mRNA in the pituitary and hypothalamus of long-term ovariectomized (OVX) rats, at different times of day. PMID:16672174
  23. proportion of the human and the rat WT GnRHR appears to be retained in the endoplasmic reticulum by calnexin, an effect that decreases GnRHR signaling capacity PMID:17170088
  24. These results, for the first time, support the transcription of GnRHR mRNA and its translation to protein in the rat oviduct throughout the postimplantation period of pregnancy. PMID:17875654
  25. Results indicate that the residues flanking Glu(7.32) of the mammalian type-I gonadotropin-releasing hormone receptor are important for antagonist as well as agonist selectivity. PMID:18319619
  26. Both cultured spinal cord neurons of rat embryos and adult rats expressed the GnRH receptor mRNA. GnRH may play other roles independently from its participation in reproductive function. PMID:19539704

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products