MRPQPSPAVPSRCREAPVPRVRAQPVGIPEAQGPVPLHSQQMRLLWGPGRPFLALLLLVS IKQVTGSLLKETTQKWANYKEKCLEDLHNRLSGIFCNGTFDRYVCWPHSYPGNVSVPCPS YLPWWNAESPGRAYRHCLAQGTWQTRENTTDIWQDESECSENHSFRQNVDHYALLYTLQL MYTVGYSVSLISLFLALTLFLFLRKLHCTRNYIHMNLFASFILKVLAVLVKDMVSHNSYS KRPDDESGWMSYLSETSVSCRSVQVLLHYFVGTNHLWLLVEGLYLHTLLEPTVFPERRLW PKYLVVGWAFPMLFVIPWGFARAHLENTRCWATNGNLKIWWIIRGPMLLCVTVNFFIFLK ILKLLISKLKAHQMCFRDYKYRLAKSTLLLIPLLGVHEVLFTFFPDDQVQGFSKRIRLFI QLTLSSVHGFLVALQYGFANGEVKAELRKSWGRFLLARHWGCRTCVLGKNFRFLGKCSKK LSEGDGSETLQKLRFSTCSSHLASETLGDVGVQPHRGRGAWPRGSSLSESSEGDFTLANT MEEILEESEI
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
This is a receptor for glucagon-like peptide 2. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.
Gene References into Functions
GLP2R expression in the rat jejunum quantified by quantitative real time PCR.PMID:25748021
Activation of the endogenous rat mucosal GLP-2 receptor is linked to activation of a cAMP/protein kinase A-dependent, growth-promoting pathway in vitro.PMID:12960094
presence of a functional GLP-2-GLP-2R axis in the developing rodent brainPMID:15059959
GLP-2 in the gut acts by activating receptors on the subepithelial myofibroblasts, causing the release of growth factors, which in turn stimulate intestinal growthPMID:15544847
normal levels of polyamines are necessary for the expression of GLP-2-induced hyperplasiaPMID:16274854
GLP-2R is expressed by vagal afferents, and intraperitoneal GLP-2 activates the vagal afferent pathwayPMID:17234710
Glucagon-like peptide 2 stimulates glucagon secretion through GLP-2r present on the alpha cell in rats.PMID:17676310