GPRPQGATVSLSETVQKWREYRHQCQRFLTEAPLLATGLFCNRTFDDYACWPDGPPGSFVNVSCPWYLPWASSVLQGHVYRFCTAEGIWLHKDNSSLPWRDLSECEESKQGERNSPEEQLLSLYIIYTVGYALSFSALVIASAILVSFRHLHCTRNYIHLNLFASFILRALSVFIKDAALKWMYSTAAQQHQWDGLLSYQDSLGCRLVFLLMQYCVAANYYWLLVEGVYLYTLLAFSVFSEQRIFKLYLSIGWGVPLLFVIPWGIVKYLYEDEGCWTRNSNMNYWLIIRLPILFAIGVNFLVFIRVICIVIAKLKANLMCKTDIKCRLAKSTLTLIPLLGTHEVIFAFVMDEHARGTLRFVKLFTELSFTSFQGFMVAVLYCFVNNEVQMEFRKSWERWRLERLNIQRDSSMKPLKCPTSSVSSGATVGSSVYAATCQNSCS
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
10xHis-SUMO-tag
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
G-protein coupled receptor for glucagon-like peptide 1 (GLP-1). Ligand binding triggers activation of a signaling cascade that leads to the activation of adenylyl cyclase and increased intracellular cAMP levels. Plays a role in regulating insulin secretion in response to GLP-1.
Gene References into Functions
Our data indicates that activation of IGF-1R and/or the IR autocrine loops resulting in beta-cell protection and function, involve mechanisms independent to the enhanced metabolic effects resulting from sustained GLP-1R activationPMID:29412813
increased GLP-1R innervation in IBD bowel could mediate enhanced visceral afferent signalling, and provide a peripheral target for therapeutic interventionPMID:29813107
Study found GLP-1/GLP-1R signaling in the brainstem to be required for the central mediation of cancer anorexia-cachexia syndrome in hepatoma tumor-bearing rats. A blockade of brainstem GLP-1 not only attenuated anorexia, but also body weight loss and muscle wasting.PMID:29247677
Results show that lateral dorsal tegmental nucleus (LDTg) GLP-1R signaling is pharmacologically and physiologically relevant for LDTg tointegrate energy balance-relevant signals to modulate feeding and provide novel evidence of gut-nucleus tractus solitarius-LDTg GLP-1 signaling.PMID:28920591
Low GLP-1R expression is associated with intestinal ischemia/reperfusion injury.PMID:30195035
These findings indicate that sitagliptin treatment regulates GLP-1R and CB-1R gene expressions, which are associated with appetite regulation in diabetic rat, and may decrease oxidative stress and liver tissue damage.PMID:28599244
Nucleus tractus solitarius GLP-1R signaling is required for the control of food intake and motivation to feed.PMID:27782127
The findings of this study indicated that increased activation of NTS GLP-1-expressing neurons by corticosterone may represent a homeostatic response to cocaine taking, thereby reducing the reinforcing efficacy of cocaine.PMID:26675243
Exendin-4 treatment decreased MI size, suppressed chamber dilation, myocyte hypertrophy, and fibrosis and improved in vivo heart function in the rats subjected to MI. Exendin-4 resulted in an increase in circulating GLP-1 and GLP-1R in ventricular tissuesPMID:28242257
The vasodilatation due to glucagon evokes via the glucagon-receptor, but also via the receptor for GLP-1, and it is endothelium-independent.PMID:26975347
Results suggest that geniposide pretreatment inhibits hypoxia/reoxygenation (H/R)-induced myocardial apoptosis by reversing mitochondrial dysfunction, an effect in part due to activation of GLP-1R and PI3K/AKT signaling pathway.PMID:27372651
Data show that GLP-1 receptor (GLP-1R) activation induced beta-catenin nuclear translocation in bone marrow stromal cells (BMSCs).PMID:26947974
Results strongly implicate the GLP-1R in mediating the unconditioned suppression of dopamine signaling by the emetic agent LiCl and support the GLP-1R as a target in the treatment of maladaptive aversive associationsPMID:26211731
hindbrain GLP1 neurons in rats are equipped to store glutamate in synaptic vesicles, and likely co-release both glutamate and GLP1 from axon varicosities and terminals in the hypothalamus and other brain regionsPMID:25012114
Glucagon-like peptide-1 receptor (GLP-1R) agonists reduce food intake and are approved by the Food and Drug Administration for the treatment of obesity, but the cellular mechanisms underlying the anorectic effects of GLP-1 require further investigation.PMID:27013681
The favorable preclinical data indicated that (18)F-Al-NOTA-MAL-Cys(39)-exendin-4may be suitable for non-invasive monitoring functional pancreatic beta cells.PMID:26850848
These results suggested that beta-cell GLP-1 receptor signaling involved activation of KATP channels via a PI3K-dependent pathway.PMID:26655814
Vagal afferent neuron knockdown of GLP1R increased meal size, accelerated gastric emptying, increased postprandial glycemia, and blunted insulin release.PMID:26470787
reduced GLP-1R expression in spontaneously hypertensive rat renal arteries most likely mediated through PKCbeta upregulationPMID:25915883
Cardioprotection Resulting from Glucagon-Like Peptide-1 Administration Involves Shifting Metabolic Substrate Utilization to Increase Energy Efficiency in the Rat Heart.PMID:26098939
Activation of the GLP-1 receptors in the nucleus of the solitary tract reduces food reward behavior and targets the mesolimbic systemPMID:25793511
these data provide novel evidence that lipotoxicity decreases the mesangial GLP-1R expression in intact cells and in vivo.PMID:26302449
induced T1DM and T2DM may differently modulate GLP-1R system in enteropancreatic axisPMID:25893200
Results illuminate novel neuronal and behavioral mechanisms mediating food intake reduction by GLP-1 via GLP-1R activation in the ventral hippocampal formationPMID:25035078
Hyperglycemia decreases GLP-1R expression in retinal pigment epithelial cells.PMID:25483438
GLP-1 receptors are located in the renal vasculature, including afferent arterioles. Activation of these receptors reduces the autoregulatory response of afferent arterioles to acute pressure increases and increases RBF in normotensive rats.PMID:25656368
GLP-1 receptor agonist increased CTRP3 expression in visceral adipose tissue of type 2 diabetic rats.PMID:25177707
glucose lowering properties of acute administration of GLP-1R agonists are not accounted for by their central effects.PMID:24879927
The results demonstrate GLP-1 receptor regulation of hippocampal function and are consistent with GLP-1 receptor agonists enhancing GABAA signaling by pre- and postsynaptic mechanisms.PMID:25114295
results indicate that GLP-1-producing neurons in the nucleus tractus solitarius project monosynaptically to the lateral parabrachial nucleus, providing a potential endogenous mechanism by which lPBN GLP-1R signaling may exert effects on food intake controlPMID:24681814
GLP-1R on POMC/CART-expressing ARC neurons likely mediates liraglutide-induced weight lossPMID:25202980
Food intake inhibitory effects of nucleus tractus solitarius GLP-1R signaling extend beyond satiation and include effects on food reward and motivation that are typically ascribed to midbrain and forebrain neurons.PMID:24944243
Data suggest that signaling involving Glp1/Glp1 receptor in hindbrain neurons (specifically area postrema) is involved in appetite regulation; analogs of GLP1 (agonists of Glp1 receptor) inhibit eating; antagonists of Glp1 receptor stimulate eating.PMID:24601880
Data suggest that responsiveness of pancreatic beta cells to glucose level resulting in secretion of insulin involves Glp1/Glp1r (glucagon-like peptide-1/glucagon-like peptide-1 receptor) signaling and GLP1/Glp1r agonists act as hypoglycemic agents.PMID:24425760
Studied GLP-1R occurrence in normal pancreas, acute pancreatitis (AP)/chronic pancreatitis (CP), and the effects of GLP-1 analog on normal PSCs, their ability to stimulate inflammatory mediator secretion or proliferation.PMID:24217090
Glucagon-like peptide 1 receptor induced suppression of food intake, and body weight is mediated by central IL-1 and IL-6.PMID:24048027
The presence of nutrients in the gut may be required for endogenous stimulation of nucleus accumbens GLP-1R.PMID:23612998
these results indicated that GLP-1 and GLP-1R are implicated in the pathogenesis of irritable bowel syndrome-C and irritable bowel syndrome-D.PMID:23338623
Glp1r activation attenuates high glucose-induced cardiomyocyte apoptosis in association with decreased ER stress and markers of enhanced SERCA2a activityPMID:23302777
GLP-1R expression is strongly up-regulated immediately after birth in neonatal rats, particular in male offspring.PMID:23354098
Pulmonary delivery of ROSE-010 inhibits gut motility through the GLP-1R similar to natural GLP-1.PMID:22960405
The effect of a GLP-1 receptor agonist on single-nephron glomerular filtration rate, proximal reabsorption, tubuloglomerular feedback responses and urine flow rate in hydropenic male Wistar and Wistar-Froemter rats is reported.PMID:23019232
in both mice and rats, peripheral GLP-1 reduces food intake significantly less than Ex-4, even when protected from DPP-4PMID:23033273
Blockade of endogenous GLP-1R signaling in the VTA and NAc core resulted in a significant increase in food intake, establishing a physiological relevance for GLP-1 signaling in the mesolimbic reward system.PMID:22128031
Glucagon-like peptide-1 receptor activation stimulates hepatic lipid oxidation and restores hepatic signalling alteration induced by a high-fat diet in nonalcoholic steatohepatitis.PMID:21745271
Endogenous GLP-1 receptor signaling is necessary for the reduction in food intake produced by jejunal linoleic acid infusions.PMID:21917638
these findings indicated that glucose fluctuation reduces GLP-1R expression through ER stress more profoundly than sustained hyperglycemia, which may contribute to the diminished response of GLP-1.PMID:21945929
GLP-1r are present on nerve terminals in hepatic portal bed, and GLP-1 antagonism localized to this region impairs glucose tolerance. These data are consistent with an important component of neural mediation of GLP-1 action. (GLP-1)PMID:17584962
Show
More
Hide
All
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 2 family
Tissue Specificity
Pancreatic islets, stomach, lung, rat insulinoma cell line.