Abbreviation
Recombinant Rat Glp1r protein, partial (Active)
Purity
Greater than 90% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Rat Glp1r at 2 μg/mL can bind Anti-GLP1R recombinant antibody (CSB-RA009514MA2HU). The EC50 is 8.630-10.66 ng/mL.
Alternative Names
Glucagon-like peptide 1 receptor; GLP-1 receptor; GLP-1-R; GLP-1R; Glp1r; Glpr
Species
Rattus norvegicus (Rat)
Expression Region
22-139aa
Target Protein Sequence
GPRPQGATVSLSETVQKWREYRHQCQRFLTEAPLLATGLFCNRTFDDYACWPDGPPGSFVNVSCPWYLPWASSVLQGHVYRFCTAEGIWLHKDNSSLPWRDLSECEESKQGERNSPEE
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
C-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Storage
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized Rat Glp1r at 2 μg/ml can bind Anti-GLP1R recombinant antibody (CSB-RA009514MA2HU). The EC50 is 8.630-10.66 ng/mL.
Description
GLP-1R mediates incretin signaling central to glucose homeostasis and cardiovascular protection, yet capturing its native extracellular architecture remains technically demanding for binding studies. This mammalian-expressed fragment spanning residues 22–139 encompasses the N-terminal ligand-binding domain and demonstrates quantifiable antibody recognition in functional ELISA, with an EC50 of 8.630–10.66 ng/mL when immobilized at 2 μg/mL, providing a validated basis for therapeutic antibody epitope mapping, competitive inhibition screening, and receptor-ligand interaction assays by ELISA, SPR, or BLI. The mammalian expression system supports native glycosylation and disulfide patterning critical for conformational epitope presentation, enabling researchers to characterize antibody affinity, screen blocking candidates, or serve as a positive control in binding assays where authentic folding is non-negotiable. Purity exceeding 90% by SDS-PAGE and endotoxin below 1.0 EU/μg align with standards expected in quantitative binding studies and antibody validation workflows targeting metabolic and cardiovascular pathways.
