Cckbr; Gastrin/cholecystokinin type B receptor; CCK-B receptor; CCK-BR; Cholecystokinin-2 receptor; CCK2-R
Species
Rattus norvegicus (Rat)
Source
in vitro E.coli expression system
Expression Region
1-452
Target Protein Sequence
MELLKLNRSVQGPGPGSGSSLCRPGVSLLNSSSAGNLSCDPPRIRGTGTRELEMAIRITL YAVIFLMSVGGNVLIIVVLGLSRRLRTVTNAFLLSLAVSDLLLAVACMPFTLLPNLMGTF IFGTVICKAISYLMGVSVSVSTLNLVAIALERYSAICRPLQARVWQTRSHAARVILATWL LSGLLMVPYPVYTMVQPVGPRVLQCMHRWPSARVQQTWSVLLLLLLFFIPGVVIAVAYGL ISRELYLGLHFDGENDSETQSRARNQGGLPGGAAPGPVHQNGGCRPVTSVAGEDSDGCCV QLPRSRLEMTTLTTPTPGPVPGPRPNQAKLLAKKRVVRMLLVIVLLFFLCWLPVYSVNTW RAFDGPGAQRALSGAPISFIHLLSYVSACVNPLVYCFMHRRFRQACLDTCARCCPRPPRA RPQPLPDEDPPTPSIASLSRLSYTTISTLGPG
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Receptor for gastrin and cholecystokinin. The CCK-B receptors occur throughout the central nervous system where they modulate anxiety, analgesia, arousal, and neuroleptic activity. This receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system.
Gene References into Functions
CCK-B receptors mediate acetylcholine release through cell bodies of cholinergic interneurons in the corpus striatum.PMID:22981453
CCK1 and CCK2 receptors are expressed on pancreatic stellate cells and induce collagen productionPMID:20843811
Pancreatic islet CCK1/2 receptors initiate somatosatin secretion through constitutive secretion controlled at the level of protein synthesis.PMID:19959964
CCK(B) receptor mediates synergistic stimulation of DNA synthesis and cyclin expressionPMID:11748587
These results indicate that CCKB, but not CCKA receptors are involved in anxiety, as tested by microinjection of cholecystokinin agonists.PMID:12373548
Genetic variations in CCK2 receptor in PVG hooded and Sprague-Dawley rats and its mRNA expression on cat exposurePMID:12708535
CCK-AR and CCK-BR gene were present in pulmonary vascular endothelial cells, macrophages, bronchial epithelial cells and alveolar epithelial cells, which play an important role in mediating the regulatory actions of CCK-8 on these cells.PMID:12800239
gastrin increased PGE2 secretion in Swiss 3T3 cells expressing the CCK2 receptorPMID:12891702
the data identified CCK-A and CCK-B receptor mRNAs in the rat retina and demonstrated that they are functional, stimulating tyrosine phosphorylation pathways.PMID:14698681
Insulin can negatively control pancreatic somatostatin mRNA and hormone content and positively control CCK(B)R mRNA; the CCK(B)R protein appears to be delayed.PMID:15161757
analysis of interspecies polymorphism in the human and rat cholecystokinin receptor-2 and its effect on the cholecystokinin binding sitePMID:15817487
The present results substantiate the view that dorsolateral periaqueductal gray CCK(2) receptors modulate panic-related behaviors.PMID:16168394
under 'basal' conditions, a portion of the glandular protein synthesis, as well as the whole increase in synthesis in response to administration of pentagastrin, engaged both types of CCK receptors.PMID:16556659
CCK(2) receptors located in the peraqueductal gray are involved in the regulation of panic-related behaviors and may mediate the effect of cholecystokinin-4 on panic.PMID:17498673
Functional postsynaptic G-protein-coupled CCK B receptors are prevalent in neonatal rodent spinal cord.PMID:17581850
CCK modulates glutamate-GABA mechanisms by acting on CCK-2 receptors via volume transmission occurring at basolateral amygdaloid nucleus and/or by synaptic or perisynaptic volume transmission in rostrolateral main and paracapsular intercalated islands.PMID:18088282
Our data indicate that CCK, acting via CCK(B) receptors, produces a long-lasting excitation of layer 6b neocortical neurons, and this action may play a critical role in modulation of corticothalamic circuit activity.PMID:19497313
Show
More
Hide
All
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Parietal cells, pancreas, brain and various neoplastic tissues.