Recombinant Rat Gastrin/cholecystokinin type B receptor (Cckbr)

Code: CSB-CF004773RA
Size:
20μg
20μg100μg
US$5877
Quantity:
Express system: in vitro E.coli expression system
Species: Rattus norvegicus (Rat)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
Cckbr
Uniprot NO.
Species
Rattus norvegicus (Rat)
Source
in vitro E.coli expression system
Expression Region
1-452
Target Protein Sequence
MELLKLNRSVQGPGPGSGSSLCRPGVSLLNSSSAGNLSCDPPRIRGTGTRELEMAIRITL YAVIFLMSVGGNVLIIVVLGLSRRLRTVTNAFLLSLAVSDLLLAVACMPFTLLPNLMGTF IFGTVICKAISYLMGVSVSVSTLNLVAIALERYSAICRPLQARVWQTRSHAARVILATWL LSGLLMVPYPVYTMVQPVGPRVLQCMHRWPSARVQQTWSVLLLLLLFFIPGVVIAVAYGL ISRELYLGLHFDGENDSETQSRARNQGGLPGGAAPGPVHQNGGCRPVTSVAGEDSDGCCV QLPRSRLEMTTLTTPTPGPVPGPRPNQAKLLAKKRVVRMLLVIVLLFFLCWLPVYSVNTW RAFDGPGAQRALSGAPISFIHLLSYVSACVNPLVYCFMHRRFRQACLDTCARCCPRPPRA RPQPLPDEDPPTPSIASLSRLSYTTISTLGPG
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Receptor for gastrin and cholecystokinin. The CCK-B receptors occur throughout the central nervous system where they modulate anxiety, analgesia, arousal, and neuroleptic activity. This receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system.
Gene References into Functions
  1. CCK-B receptors mediate acetylcholine release through cell bodies of cholinergic interneurons in the corpus striatum. PMID:22981453
  2. CCK1 and CCK2 receptors are expressed on pancreatic stellate cells and induce collagen production PMID:20843811
  3. Pancreatic islet CCK1/2 receptors initiate somatosatin secretion through constitutive secretion controlled at the level of protein synthesis. PMID:19959964
  4. CCK(B) receptor mediates synergistic stimulation of DNA synthesis and cyclin expression PMID:11748587
  5. These results indicate that CCKB, but not CCKA receptors are involved in anxiety, as tested by microinjection of cholecystokinin agonists. PMID:12373548
  6. Genetic variations in CCK2 receptor in PVG hooded and Sprague-Dawley rats and its mRNA expression on cat exposure PMID:12708535
  7. CCK-AR and CCK-BR gene were present in pulmonary vascular endothelial cells, macrophages, bronchial epithelial cells and alveolar epithelial cells, which play an important role in mediating the regulatory actions of CCK-8 on these cells. PMID:12800239
  8. gastrin increased PGE2 secretion in Swiss 3T3 cells expressing the CCK2 receptor PMID:12891702
  9. the data identified CCK-A and CCK-B receptor mRNAs in the rat retina and demonstrated that they are functional, stimulating tyrosine phosphorylation pathways. PMID:14698681
  10. Insulin can negatively control pancreatic somatostatin mRNA and hormone content and positively control CCK(B)R mRNA; the CCK(B)R protein appears to be delayed. PMID:15161757
  11. analysis of interspecies polymorphism in the human and rat cholecystokinin receptor-2 and its effect on the cholecystokinin binding site PMID:15817487
  12. The present results substantiate the view that dorsolateral periaqueductal gray CCK(2) receptors modulate panic-related behaviors. PMID:16168394
  13. under 'basal' conditions, a portion of the glandular protein synthesis, as well as the whole increase in synthesis in response to administration of pentagastrin, engaged both types of CCK receptors. PMID:16556659
  14. CCK(2) receptors located in the peraqueductal gray are involved in the regulation of panic-related behaviors and may mediate the effect of cholecystokinin-4 on panic. PMID:17498673
  15. Functional postsynaptic G-protein-coupled CCK B receptors are prevalent in neonatal rodent spinal cord. PMID:17581850
  16. CCK modulates glutamate-GABA mechanisms by acting on CCK-2 receptors via volume transmission occurring at basolateral amygdaloid nucleus and/or by synaptic or perisynaptic volume transmission in rostrolateral main and paracapsular intercalated islands. PMID:18088282
  17. Our data indicate that CCK, acting via CCK(B) receptors, produces a long-lasting excitation of layer 6b neocortical neurons, and this action may play a critical role in modulation of corticothalamic circuit activity. PMID:19497313

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Parietal cells, pancreas, brain and various neoplastic tissues.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products