MDWGTLQSILGGVNKHSTSIGKIWLTVLFIFRIMILVVAAKEVWGDEQADFVCNTLQPGC KNVCYDHYFPISHIRLWALQLIMVSTPALLVAMHVAYRRHEKKRKFMKGEIKNEFKDIEE IKTQKVRIEGSLWWTYTTSIFFRVIFEAVFMYVFYIMYNGFFMQRLVKCNAWPCPNTVDC FISRPTEKTVFTVFMISVSGICILLNITELCYLFIRYCSGKSKRPV
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Structural component of gap junctions. Gap junctions are dodecameric channels that connect the cytoplasm of adjoining cells. They are formed by the docking of two hexameric hemichannels, one from each cell membrane. Small molecules and ions diffuse from one cell to a neighboring cell via the central pore.
Gene References into Functions
These results demonstrate that chronic prenatal hypoxia caused hearing impairment, and suggest that promoter region hypermethylation and expression downregulation of Cx26 underlie the mechanism of actionPMID:29207085
Reduced expression of Connexin26 and its DNA promoter hypermethylation in the inner ear of mimetic aging rats might contribute to the development of presbycusis.PMID:25159847
the surface topography of Cx26 hemichannelsPMID:25365227
Increased expression of connexin 26 protein and mRNA expression in the cochlear lateral wall were detected 3 h after the single injection of gentamicin.PMID:22896926
Changes in Cx43 expression following engraftment of neural stem cells to striatal tissue.PMID:20654614
T135 and P87 residues are in positions that are important for connexin26 oligomer stability and can affect gap junction gating.PMID:20441744
Data show that knowledge of the PTMs of Cx26 will be instrumental in understanding how alterations in the cellular mechanisms of Cx26 channel biogenesis and function lead to losses in auditory function and disfiguring skin disorders.PMID:19775242
Data show that mechanical stress of urothelial cells activates in vivo JNK, as a consequence of a regulated expression of IB1/JIP-1, and that urothelial connexin 26 may be directly regulated by the AP-1 complex [connexin 26].PMID:12064607
Data show that connexins are differentially expressed in rat gray matter: Cx26, Cx30 and Cx43 were found only in astrocyte gap junctions; Cx32 was only in oligodendrocytes, and Cx36 was only in neurons [connexin 26]PMID:12064610
We report the identification of a novel Cx26 point mutation (439 G-->A) linked to familial, autosomal recessive, sensorineural hearing loss.PMID:14676473
Endometrial expression of Cx26 and Cx43 is induced via estrogen and ERalpha during preimplantation but then utilizes an estrogen receptor-independent signaling pathway during embryo implantation and decidualization.PMID:15028626
Cx26 forms gap junctions, but not heterotrimeric channels in co-expressing cells.PMID:15128867
Aberrant methylation of the Cx26 gene may be involved in the development of lung adenocarcinomas induced by N-nitrosobis(2-hydroxypropyl)amine in rats.PMID:16637067
Cx43 and Cx26 collectively co-regulate epidermal differentiation from basal keratinocytes but play a more minimal role in the maintenance of established epidermisPMID:17693411
the gap junction subunits connexin 26 (Cx26) and connexin 43 (Cx43) are expressed at the contact points between radial fibres and migrating neurons, and acute downregulation of Cx26 or Cx43 impairs the migration of neurons to the cortical platePMID:17713529
increased CX26 expression is associated with differentiation of keratinocytesPMID:19194037
Show
More
Hide
All
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.
Protein Families
Connexin family, Beta-type (group I) subfamily
Tissue Specificity
Liver, kidney, intestine, lung, spleen, stomach, testis and brain, but not heart and adult skeletal muscle.