Recombinant Rat Gap junction beta-2 protein (Gjb2)

Code: CSB-CF009452RA
Size:
20μg
20μg100μg
US$4185
Quantity:
Express system: in vitro E.coli expression system
Species: Rattus norvegicus (Rat)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
Gjb2
Uniprot NO.
Species
Rattus norvegicus (Rat)
Source
in vitro E.coli expression system
Expression Region
1-226
Target Protein Sequence
MDWGTLQSILGGVNKHSTSIGKIWLTVLFIFRIMILVVAAKEVWGDEQADFVCNTLQPGC KNVCYDHYFPISHIRLWALQLIMVSTPALLVAMHVAYRRHEKKRKFMKGEIKNEFKDIEE IKTQKVRIEGSLWWTYTTSIFFRVIFEAVFMYVFYIMYNGFFMQRLVKCNAWPCPNTVDC FISRPTEKTVFTVFMISVSGICILLNITELCYLFIRYCSGKSKRPV
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Structural component of gap junctions. Gap junctions are dodecameric channels that connect the cytoplasm of adjoining cells. They are formed by the docking of two hexameric hemichannels, one from each cell membrane. Small molecules and ions diffuse from one cell to a neighboring cell via the central pore.
Gene References into Functions
  1. These results demonstrate that chronic prenatal hypoxia caused hearing impairment, and suggest that promoter region hypermethylation and expression downregulation of Cx26 underlie the mechanism of action PMID:29207085
  2. Reduced expression of Connexin26 and its DNA promoter hypermethylation in the inner ear of mimetic aging rats might contribute to the development of presbycusis. PMID:25159847
  3. the surface topography of Cx26 hemichannels PMID:25365227
  4. Increased expression of connexin 26 protein and mRNA expression in the cochlear lateral wall were detected 3 h after the single injection of gentamicin. PMID:22896926
  5. Changes in Cx43 expression following engraftment of neural stem cells to striatal tissue. PMID:20654614
  6. T135 and P87 residues are in positions that are important for connexin26 oligomer stability and can affect gap junction gating. PMID:20441744
  7. Data show that knowledge of the PTMs of Cx26 will be instrumental in understanding how alterations in the cellular mechanisms of Cx26 channel biogenesis and function lead to losses in auditory function and disfiguring skin disorders. PMID:19775242
  8. Data show that mechanical stress of urothelial cells activates in vivo JNK, as a consequence of a regulated expression of IB1/JIP-1, and that urothelial connexin 26 may be directly regulated by the AP-1 complex [connexin 26]. PMID:12064607
  9. Data show that connexins are differentially expressed in rat gray matter: Cx26, Cx30 and Cx43 were found only in astrocyte gap junctions; Cx32 was only in oligodendrocytes, and Cx36 was only in neurons [connexin 26] PMID:12064610
  10. We report the identification of a novel Cx26 point mutation (439 G-->A) linked to familial, autosomal recessive, sensorineural hearing loss. PMID:14676473
  11. Endometrial expression of Cx26 and Cx43 is induced via estrogen and ERalpha during preimplantation but then utilizes an estrogen receptor-independent signaling pathway during embryo implantation and decidualization. PMID:15028626
  12. Cx26 forms gap junctions, but not heterotrimeric channels in co-expressing cells. PMID:15128867
  13. Aberrant methylation of the Cx26 gene may be involved in the development of lung adenocarcinomas induced by N-nitrosobis(2-hydroxypropyl)amine in rats. PMID:16637067
  14. Cx43 and Cx26 collectively co-regulate epidermal differentiation from basal keratinocytes but play a more minimal role in the maintenance of established epidermis PMID:17693411
  15. the gap junction subunits connexin 26 (Cx26) and connexin 43 (Cx43) are expressed at the contact points between radial fibres and migrating neurons, and acute downregulation of Cx26 or Cx43 impairs the migration of neurons to the cortical plate PMID:17713529
  16. increased CX26 expression is associated with differentiation of keratinocytes PMID:19194037

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.
Protein Families
Connexin family, Beta-type (group I) subfamily
Tissue Specificity
Liver, kidney, intestine, lung, spleen, stomach, testis and brain, but not heart and adult skeletal muscle.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products