Home
Product
Protein
Transmembrane Proteins
Recombinant Rat Gamma-secretase subunit PEN-2 (Psenen)

Recombinant Rat Gamma-secretase subunit PEN-2 (Psenen)

Code: CSB-CF757686RA

Rate （N/A）
Review （0）

Size:

20μg100μg

US$3250

Quantity:

Express system: in vitro E.coli expression system

Species: Rattus norvegicus (Rat)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

Psenen

Uniprot NO.

Q6QI68

Alternative Names

Psenen; Gamma-secretase subunit PEN-2; Liver regeneration-related protein LRRGT00140; Presenilin enhancer protein 2

Species

Rattus norvegicus (Rat)

Source

in vitro E.coli expression system

Expression Region

1-101

Target Protein Sequence

MNLERVSNEEKLNLCRKYYLGGFAFLPFLWLVNIFWFFKEAFFAPAYTEQSQIKGYVWRS AVGFLFWVIVLTTWITIFQIYRPRWGALGDYLSFTIPLGTP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Essential subunit of the gamma-secretase complex, an endoprotease complex that catalyzes the intramembrane cleavage of integral membrane proteins such as Notch receptors and APP (amyloid-beta precursor protein). The gamma-secretase complex plays a role in Notch and Wnt signaling cascades and regulation of downstream processes via its role in processing key regulatory proteins, and by regulating cytosolic CTNNB1 levels. PSENEN modulates both endoproteolysis of presenilin and gamma-secretase activity.

Gene References into Functions

These results indicate that concerted differentiation of pancreatic precursor cell aggregates into functionally mature islet-like clusters can be achieved in poly(ethylene glycol)-based hydrogel cultures. PMID:20236034
Nicastrin, presenilin 1, APH-1, and PEN-2 form an active gamma-secretase complex expressed in mitochondria. PMID:15456764

Hide All

Subcellular Location

Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus, Golgi stack membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein. Membrane; Multi-pass membrane protein.

Protein Families

PEN-2 family

Database Links

UNIGENE: Rn.1240

KEGG: rno:292788

STRING: 10116.ENSRNOP00000028438

Promotions