Recombinant Rat Fatty acid desaturase 2 (Fads2)

Code: CSB-CF007960RA

Rate （N/A）
Review （0）

Size:

20μg100μg

US$5817

Quantity:

Express system: in vitro E.coli expression system

Species: Rattus norvegicus (Rat)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

Fads2

Uniprot NO.

Q9Z122

Species

Rattus norvegicus (Rat)

Source

in vitro E.coli expression system

Expression Region

1-444

Target Protein Sequence

MGKGGNQGEGSTELQAPMPTFRWEEIQKHNLRTDRWLVIDRKVYNVTKWSQRHPGGHRVI GHYSGEDATDAFRAFHLDLDFVGKFLKPLLIGELAPEEPSLDRGKSSQITEDFRALKKTA EDMNLFKTNHLFFFLLLSHIIVMESIAWFILSYFGNGWIPTVITAFVLATSQAQAGWLQH DYGHLSVYKKSIWNHIVHKFVIGHLKGASANWWNHRHFQHHAKPNIFHKDPDIKSLHVFV LGEWQPLEYGKKKLKYLPYNHQHEYFFLIGPPLLIPMYFQYQIIMTMIRRRDWVDLAWAI SYYARFFYTYIPFYGILGALVFLNFIRFLESHWFVWVTQMNHIVMEIDLDHYRDWFSSQL AATCNVEQSFFNDWFSGHLNFQIEHHLFPTMPRHNLHKIAPLVKSLCAKHGIEYQEKPLL RALLDIVSSLKKSGELWLDAYLHK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Involved in the biosynthesis of highly unsaturated fatty acids (HUFA) from the essential polyunsaturated fatty acids (PUFA) linoleic acid (LA) (18:2n-6) and alpha-linolenic acid (ALA) (18:3n-3) precursors, acting as a fatty acyl-coenzyme A (CoA) desaturase that introduces a cis double bond at carbon 6 of the fatty acyl chain. Catalyzes the first and rate limiting step in this pathway which is the desaturation of LA (18:2n-6) and ALA (18:3n-3) into gamma-linoleate (GLA) (18:3n-6) and stearidonate (18:4n-3), respectively. Subsequently, in the biosynthetic pathway of HUFA n-3 series, it desaturates tetracosapentaenoate (24:5n-3) to tetracosahexaenoate (24:6n-3), which is then converted to docosahexaenoate (DHA)(22:6n-3), an important lipid for nervous system function. It can also desaturate (11E)-octadecenoate (trans-vaccenoate) at carbon 6 generating (6Z,11E)-octadecadienoate. In addition to Delta-6 activity, this enzyme exhibits Delta-8 activity with slight biases toward n-3 fatty acyl-CoA substrates.

Gene References into Functions

We first showed that both recombinant and native rat FADS2 were able to Delta6-desaturate not only the cis9- but also the cis12- and cis15-18:1 isomers. PMID:25701799
Delta-6-desaturase links polyunsaturated fatty acid metabolism with phospholipid remodeling and disease progression in heart failure. PMID:24284026
epigenetic regulation of Fads2 may contribute to short- and long-term regulation of PUFA synthesis PMID:23107313
Changes in progesterone and oestradiol during pregnancy may promote the synthesis of LC PUFA via increased FADS2 expression. PMID:22495065
Data show that an imbalance of maternal micronutrients increases Delta5 desaturase activity but decreases mRNA levels, decreases Delta6 desaturase activity but not mRNA levels as compared to control. PMID:22133376
Results show that delta-6 desaturase as well as elongase-6 expressions were upregulated in 3-month-old Zucker fatty rats as compared to lean littermates. PMID:21172452
Regulation of 6-desaturase expression is different in female vs. male liver (but not cerebral cortex) during n-3 fatty acid repletion. PMID:19157821
Delta6-desaturase acts on 24-carbon fatty acids in very-long-chain polyunsaturated fatty acid biosynthesis PMID:11988075
rat Delta 6-desaturase, which acts on the 18- and 24-carbon fatty acids of the n-6 and n-3 series, is also able to catalyze palmitic acid Delta 6 -desaturation PMID:12562851
n-6 and n-3 PUFAs suppressed the hepatic expression of Fads2 by inhibiting the rate of Fads2 gene transcription. In contrast, consumption of the PPARalpha activator WY 14,643 significantly enhanced the transcription of hepatic DeFads2 by 500%. PMID:12562861
testicular distribution of Delta5- and Delta6-desaturase and stearoyl-CoA desaturase 1 and 2 shows that all four desaturases seem to be localized in the Sertoli cells, with far lower expression in germ cells PMID:12606372
Using 6-mon-old eSS rats that had already developed insulin resistance, we investigated the changes evoked on delta9, delta6, and delta5 liver desaturases PMID:14577661
The delta 6-desaturase activity was significantly increased, whereas gene expression tended to decrease. PMID:15589689

Hide All

Subcellular Location

Endoplasmic reticulum membrane; Multi-pass membrane protein. Microsome membrane; Multi-pass membrane protein.

Protein Families

Fatty acid desaturase type 1 family

Tissue Specificity

Expressed in the liver and brain (at protein level). Highest activity is found in the liver and adrenals followed by the testes and other organs, absent in adipose tissue.

Database Links

UNIGENE: Rn.162483

KEGG: rno:83512

STRING: 10116.ENSRNOP00000027756

Promotions