Home
Product
Protein
Transmembrane Proteins
Recombinant Rat Epithelial cell adhesion molecule (Epcam)

Recombinant Rat Epithelial cell adhesion molecule (Epcam)

Code: CSB-CF007717RA

Rate （N/A）
Review （0）

Size:

20μg100μg

US$4679

Quantity:

Express system: in vitro E.coli expression system

Species: Rattus norvegicus (Rat)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

Epcam

Uniprot NO.

O55159

Alternative Names

Epcam; Tacstd1; Epithelial cell adhesion molecule; Ep-CAM; Epithelial glycoprotein 314; EGP314; Protein D5.7A; Tumor-associated calcium signal transducer 1; CD antigen CD326

Species

Rattus norvegicus (Rat)

Source

in vitro E.coli expression system

Expression Region

24-315

Target Protein Sequence

QKDCVCNNYKLTSRCYENENGECQCTSYGTQNTVICSKLASKCLVMKAEMTHSKSGRRMKPEGAIQNNDGLYDPECDEQGLFKAKQCNGTATCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKERAQPYNFESLHTALQDTFASRYMLNPKFIKSIMYENNVITIDLMQNSSQKTQDDVDIADVAYYFEKDVKGESLFHSSKSMDLRVNGELLDLDPGQTLIYYVDEKAPEFSMQGLTAGIIAVIVVVVLAVIAGIVVLVISTRKRSAKYEKAEIKEMGEIHRELNA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

May act as a physical homophilic interaction molecule between intestinal epithelial cells (IECs) and intraepithelial lymphocytes (IELs) at the mucosal epithelium for providing immunological barrier as a first line of defense against mucosal infection. Plays a role in embryonic stem cells proliferation and differentiation. Up-regulates the expression of FABP5, MYC and cyclins A and E.

Gene References into Functions

These results suggest that, prior to implantation, EpCAM mediates intercellular adhesion in the uterine epithelium. PMID:25367431
EpCAM overexpression is asociated with hepatic tumors. PMID:23098445
An association between Tacstd1/EpCam and claudin-7 is noted in rat and human tumors and in non-transformed tissues of the gastrointestinal tract. PMID:16054130

Hide All

Subcellular Location

Lateral cell membrane; Single-pass type I membrane protein. Cell junction, tight junction.

Protein Families

EPCAM family

Database Links

UNIGENE: Rn.106481

KEGG: rno:171577

STRING: 10116.ENSRNOP00000021135

Promotions