Ednra; Endothelin-1 receptor; Endothelin receptor type A; ET-A; ET-AR
Species
Rattus norvegicus (Rat)
Source
in vitro E.coli expression system
Expression Region
21-426
Target Protein Sequence
DNAERYSANLSSHVEDFTPFPGTEFNFLGTTLQPPNLALPSNGSMHGYCPQQTKITTAFK YINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIASLALGDLIYVVIDLPINVFK LLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALSVDRYRAVASWSRVQGIGIPL ITAIEIVSIWILSFILAIPEAIGFVMVPFEYKGEQHRTCMLNATTKFMEFYQDVKDWWLF GFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQRREVAKTVFCLVVIFALCWF PLHLSRILKKTVYDEMDKNRCELLSFLLLMDYIGINLATMNSCINPIALYFVSKKFKNCF QSCLCCCCHQSKSLMTSVPMNGTSIQWKNQEQNHNTERSSHKDSMN
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Receptor for endothelin-1. Mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. The rank order of binding affinities for ET-A is: ET1 > ET2 >> ET3.
Gene References into Functions
Homocysteine up-regulates ETA receptor expression via the Sirt1/ERK1/2 signaling pathway in vascular smooth muscle cells.PMID:28579512
The results presented herein show that ETB receptors (R) have much weaker Ca(2+)-sensitizing effect than ETA-R and that ETB-R appear to be more dependent on Ca(2+) influx presumably through voltage-gated Ca(2+) channels (VGCC).PMID:28757442
endocytosis of ETA receptors following ligand binding preserves their active state by protection against antagonist.PMID:28412414
Expression of smooth muscle proteins and both ETA and ETB by the endovascular trophoblast enable it to contract upon activation of both receptors by ET1.PMID:27697218
both ETA and ETB receptor expression in the renal cortex were significantly attenuated by ovariectomy, and this reduction was not evident in OVX+E2 rats. SIGNIFICANCE: These data suggest that ovarian hormones regulate ET receptor expression and may contribute to sex differences in cardiovascular and renal health.PMID:26776836
ETaR siRNA is capable of down-regulating the expression of inflammatory and transcription factors among endothelial cells treated with hypoxia.PMID:27997891
Confirm the presence of ETA-ETB receptor cross-talk in the rat basilar artery.PMID:26528589
data suggest that ET receptors may be an important actor in diabetes-related liver damage.PMID:24918345
ET-1/ET-3 induce down-regulation of ET-A receptor mrna in coronary arteries, but do affect protein levels or vasoconstrictor response.PMID:25891848
Data show that the protein expression of the endothelin receptors ETA and ETB was significantly elevated in male growth-restricted offspring.PMID:26459423
ETA receptor-dependent vasoconstriction is missing and angiotensin II-dependent vasoconstriction is attenuated in blood pressure-lowering treatment with atrasentan in transgenic ratsPMID:25255392
Cirrhotic rats with diabetes showed higher intrahepatic ET-1 vasoresponsiveness than normoglycemic cirrhotic rats. This effect may be related, at least in part, to intrahepatic ETA R receptor and pERK over-expression.PMID:24636620
The aim was to quantify the density of ETA and ETB receptors in cardiopulmonary tissue from pulmonary arterial hypertension patients and the monocrotaline (MCT) rat.PMID:24582810
The results of this study demonstrate that expression of ETA receptors does not change with postnatal development.PMID:24815227
Endothelin-A receptor antagonist BQ-123 impeded the formation and spread of pentylenetetrazole-induced seizures to a great degree.PMID:24449761
Data implicate endothelin ETA receptors in baroreflex and vascular derangements which predispose to the hypertensive effect of cyclosporine A.PMID:24486390
In rat pulmonary small arteries, ET-1 induces receptor-operated calcium influx via the ETA receptor, and that this influx interacts with InsP3-receptor activation.PMID:24157978
Report effect of antidiabetic agents on endothelin receptor subtype(s) regulation/binding in type 1 diabetic rat hearts.PMID:24144054
The inner medullary collecting ducts in the nephron segment from male and female rats have similar ETB expression, whereas male rats have significantly higher ETA expression.PMID:23946290
The results suggest that the ET(A)/ET(B) receptors play an important role in cerebral vasospasm after subarachnoid hemorrhagePMID:23351051
In rat trigeminal ganglion neurons, ETA activation leads to TRPV1 hyperactivation via PKC activation.PMID:23396520
Secondhand smoke exposure induces transcriptional upregulation of the 5-HT(2A), ET(B) and ET(A) receptors in rat bronchial smooth muscle cells.PMID:22952915
Arterial smooth muscle ETA-receptor function displays agonist-dependent aspects; this involves roles of amino acids on position 6 and 7 of the endothelin sequencePMID:22406300
Our results demonstrated that ETA-R blockage is more effective in inhibiting free radical generation and improving heart antioxidant properties than ETB-R blockage under oxidative stress.PMID:23047940
expression in articular cartilage is increased in response to both surgical induction of osteoarthritis and TGFalpha treatmentPMID:22407503
ET(A)-ET(B) receptor cross-talk is present in the rat basilar arteryPMID:22258095
Marked decrease of mossy fiber endothelin receptor A following ischemia may contribute to glutamate release from mossy fiber terminals, thus enhancing excitotoxic effects on their cornu ammonis synaptic targets.PMID:21801590
Downregulation of the ET-A receptor impacts the potential influence of the endothelin system on the intra-axonal cascade of events underlying diffuse axonal injury.PMID:21801594
Antagonism of endothelin receptor A, but not endothelin receptor B, improves behavioral outcome following traumatic brain injury.PMID:21801595
Activation of ETA receptors contributes to the impaired responsiveness of renal mechanosensory nerves in rats with congestive heart failure by a mechanism(s) at the renal sensory nerve endings.PMID:20628427
results demonstrate an important role of endothelin in mediating diuretic responses to intramedullary infusion of hyperosmotic NaCl. Data suggest ET(A) and ET(B) receptors are both required for the full diuretic and natriuretic actions of endothelin.PMID:20844020
findings suggest that endothelins, acting through ET(A) and/or ET(B) receptors, may play an important role in mediating pain resulting from activation of most trigeminal nerve branchesPMID:20450894
Over-expression of ET(A) and leptin account-ing for the testis dysfunction is likely to be mediated by pPKCvarepsilon in the iso-proterenol treated rats.PMID:20307649
There was no correlation of ETRA expression with alveolar-arterial oxygen gradient in rats with hepatopulmonary syndrome.PMID:16463654
Altered expression of EDNRA is an early event in lung morphogenesis in the nitrofen model.PMID:19851775
GRK2 is a key regulator of ET(A)R responsiveness in resistance arteries.PMID:19748906
ET(A) and/or ET(B) receptors play an important role in I/R-induced mucosal dysfunctionPMID:11897624
ET-1-induced venoconstriction was mediated by ET(A) receptors in mesenteric blood vessels from deoxycorticosterone acetate (DOCA-salt) hypertensive and normotensive control ratsPMID:11910302
the ET(A) receptor may be present in the capillary wall of the rat skeletal muscle, including the endotheliumPMID:12074645
Expression of the ETA receptor was not affected by cloprostenol. The reversal of PGF(2alpha)'s luteolytic effect by an ETA receptor antagonist suggests that ET-1 may take part in the PGF(2alpha)-induced luteolysis in the rat.PMID:12211063
ET(A) response in hepatic stellate cells is regulated by protein kinase A (PKA)-dependent receptor phosphorylation and internalization.PMID:12297833
in endotheline-1 stimulated increase in calcium signaling in astrocytes, ET(A) was expressed more than ET(B) suggesting that ET(A) is the major receptorPMID:12464391
ETA receptor blockade enhances kidney tubular cell proliferation, cyst number, and size and reduces renal circulation.PMID:12538737
ET(A) receptors are expressed and functionally coupled to rise of [Ca(2+)](i) in H9c2 cardiomyoblasts.PMID:12628492
A functional ETA receptor activating a Ca2+-dependent pathway is expressed in Henle's loop and this ETA-induced calcium signaling is impaired in two strains of genetically hypertensive rats.PMID:12631344
Upregulation in the immunoexpression and number of astrocytes expressing the ET(B)R in both gray and white matter and near disappearance of ET(B)R-IR in ependymal cells and ET(A)R-IR in primary afferent fibers following spinal cord injuryPMID:12668144
that endothelin ET(A) receptors located on the sympathetic nerve terminals play a role in the inhibition of noradrenaline release from the rat stomach; inhibition is carried out by pertussis toxin-sensitive and indomethacin-insensitive mechanismsPMID:12686728
ET receptor subtype (ET(A) and ET(B)) mRNAs were shown to be higher in bladders of 3-week- compared to 3-month- or 22-month-old rats.PMID:12700883
cardiac nuclei possess both endothelin A and endothelin B receptor subtypes, which are functional with respect to ligand binding and are coupled to signaling mechanisms within the nuclear membranePMID:12756260
in acute necrotizing pancreatitis, associated development of microcirculatory failure, inflammation, and parenchymal injury is caused by ETs coupling onto the ETA receptorPMID:12799311