MDPLNLSWYDDDLERQNWSRPFNGSEGKADRPHYNYYAMLLTLLIFIIVFGNVLVCMAVS REKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTA SILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMIAIVWVLSFTISCPLLFGLNNTDQN ECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRKRRKRVNTKRSSRAFRANLKTPL KGNCTHPEDMKLCTVIMKSNGSFPVNRRRMDAARRAQELEMEMLSSTSPPERTRYSPIPP SHHQLTLPDPSHHGLHSNPDSPAKPEKNGHAKIVNPRIAKFFEIQTMPNGKTRTSLKTMS RRKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNS AVNPIIYTTFNIEFRKAFMKILHC
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Dopamine receptor whose activity is mediated by G proteins which inhibit adenylyl cyclase. Positively regulates postnatal regression of retinal hyaloid vessels via suppression of VEGFR2/KDR activity, downstream of OPN5.
Gene References into Functions
Results indicate that D2 receptors modulate [(3)H]GABA release at striatopallidal terminals by activating the PLC-->IP3-->Calcineurin-signaling cascade, the same one that modulates excitability in soma. Additionally, D2 receptors inhibit release when AC is active. Both mechanisms appear to converge to regulate the activity of presynaptic L-type Ca(2+) channels.PMID:29292080
D2R knockdown in neurons whose cell bodies reside in the ventral tegmental area (VTA) shifted discounting curve to the left, indicating a preference for the smaller, immediate reward, whereas the curve for control rats remained stable and unchanged. Results demonstrate that a decrease in VTA D2Rs enhances choice impulsivity.PMID:29287910
more than half of parvalbumin neuron co-express high levels of alpha7 subunit of nicotinic acetylcholine receptor and/or D2-subtype of dopamine receptorPMID:28834708
Pre- and postsynaptic colocalization of kappa opioid receptor and D2R supports a role for kappa opioid receptor potentiating both the D2R inhibitory autoreceptor function and the inhibitory action of D2R on efferent medium spiny neurons. Kappa opioid receptor co-activation accelerates D2R sensitization by contributing to decrease dopamine release in the nucleus accumbens.PMID:28531297
Dopamine D2 receptor antagonism differentially affects aversive memory formation after acute or long-term sugar consumption. Results demonstrate that nucleus accumbens dopamine D2 receptors have a differential function during conditioned taste aversion depending on the degree of sugar familiarity.PMID:28716589
The prefrontal expression of distinct D2 dopamine receptor splice variants is supposed to be implicated in cognitive decline caused by early life immune challenge.PMID:28673768
Study examined the impact of D2 receptor activation and inhibition on the anxiogenic response to cocaine using a runway model of self-administration that is sensitive to the dual and opposing effects of the drug. Results demonstrate that activity at the D2 receptor in the lateral habenula serves to modulate the anxiogenic response to cocaine.PMID:27155504
Study provided pharmacological evidence for that activation of the ventral pallidum D2 dopamine receptors enhances memory consolidation and the long-term stability of the formed memory in inhibitory avoidance learning.PMID:28057528
Data provide evidences for the important role of ventral pallidum D2 dopamine receptors in the consolidation and stabilization of spatial memory.PMID:27392640
Transient activation of mGluRs decreased the GIRK current evoked by GABAB and D2 receptors, although less efficaciously for D2.PMID:28009293
These results show that junk food diet-induced obesity reduces ethanol drinking, and suggest that increased D2R autoinhibition in the VTA may contribute to deficits in DAergic signaling and reward hypofunction observed with obesity.PMID:28859110
Fetal alcohol exposure increased the expression levels of miR-9, reduced levels of D2r and increased levels of Prl in the pituitary, and in plasma.PMID:28710248
The present study suggested that amphetamine-induced circling behavior indicated striatal dopaminergic alterations and that dopamine transporter and dopamine D2 receptor binding could be key markers for predicting motor dysfunction after mild focal ischemia.PMID:26911894
Results suggest that adolescents may be more susceptible to relapse due to a deficit in cue extinction learning, and highlight the significance of D2R signaling in the infralimbic cortex for cue extinction during adolescencePMID:26946126
The data demonstrate an association between the anxious behavior of rats with A2/A2 genotype by DRD2 locus Taq 1A and the structural organization of cerebral basolateral nucleus of the amygdaloid complex in WAG/Rij rats with polymorphic variants of this locus.PMID:27878728
We encountered significant differences in the effect of neonatal lesion in the ventral hippocampus on drd2 and drd3 mRNA expression levels among the brain regions analyzed in rat adulthood. These findings suggest that expression levels of some dopamine receptors may be regulated during adulthood, leading to behavioral and neurochemical changes associated with schizophrenia.PMID:28096775
avoidance stress induced visceral hyposensitivity through peripheral CRF receptor type 2 and central dopamine D2 receptor, but not through opioid pathwaysPMID:26662216
The CaMKIIalpha-calmodulin complex changes the affinity of dopamine (DA)-D2R causing DA to break free and bind with calmodulin.PMID:26446938
results indicate that D2Rs inhibit SFK (mainly Fyn) phosphorylation in the striatumPMID:26777117
D2DR expression in the ventral striatum also negatively correlated with impulsive responding, independently of dietPMID:26527415
The role of DRD2-CaMKIIalpha signaling is functionally reversed within the basolateral amygdala-medial prefrontal cortex pathway depending on opiate exposure statePMID:26174594
Findings suggest that dopamine, through D2 receptors in the deep layers of the superior colliculus and dorsal periaqueductal gray, is involved in defense reactions that are organized in the midbrain tectumPMID:26455877
The D2R is mainly distributed in glomus cells in the rat carotid body, suggesting that D2R plays a role in the inhibitory modulation of chemosensory activity in a paracrine and/or autocrine manner.PMID:26272445
Results link reduced expression of both the D2R and Wntless to the explicit motivation for heroin rather than to differences in total drug intake per sePMID:26501177
stress exposure induces a hypodopaminergic status accompanied by increased mRNA levels of the dopamine receptor type 2 (Drd2) in the orbitofrontal cortexPMID:26233608
Study provides evidence of expression of a catecholamine receptor, D2-like immunoreactivity, in the rat nucleus incertusPMID:26300469
fetal alcohol-exposed rats had increased levels of pituitary weight, prolactin protein and mRNA, and plasma PRL and decreased pituitary levels of dopamine D2 receptor (D2R) mRNA and protein and increased pituitary levels of D2R promoter methylation.PMID:26509893
The dopamine D2 receptor has a relevant role in the retrieval process of pre-exposure learning.PMID:26345345
findings show that D2-like dopamine receptors in the ventral tegmental area and nucleus accumbens play an important role in the lateral hypothalamus-mediated modulation of nociceptive information in the acute model of pain in the rats.PMID:26166189
Results suggested that maternal stress can permanently alter the offspring's addictive behavior and D2 receptors' expressionPMID:26192093
This study demonstrated that VTA D2R knockdown results in increased incentive motivation, but does not directly promote other aspects of addiction-like behavior.PMID:25735756
individual differences in risk-preference, as well as real-time risky decision-making, can be largely explained by the encoding in dopamine receptor type-2-expressing nucleus accumbens cells of prior unfavourable outcomes during decision-makingPMID:27007845
Early life stress enhanced the susceptibility to late life stress and resistance to escitalopram treatment through decreasing microRNA-9 expression and subsequently upregulating dopamine receptor D2 expression in the nucleus accumbensPMID:25740916
data suggest important but dissociable roles of dopamine D1 and D2 receptors in impulse control; the preference of delayed rewards depends on D1 receptors, whereas acute cocaine inhibited impulsive choice by activating D2 receptors in the basolateral amygdalaPMID:25823760
increased expression of RAGE may play a role in the pathogenesis of PH in nitrofen-induced CDH.PMID:25783380
Dopamine deficiency induces compensatory activation of tyrosine hydroxylase via phosphorylation at 40Ser through D2-autoreceptor and PKA-mediated pathways.PMID:26225746
This study demonstrated that reduced striatal D2 may be related to individual vulnerability to stress-induced reinstatement of heroin- seeking.PMID:25446223
These results suggest that D2R activation induces a Gbetagamma- and extracellular signal-regulated kinase 1/2-dependent increase in the level of Zif268, which functions to directly up-regulate the expression of GDNF.PMID:23373701
results suggest that stress-induced activation of medial prefrontal cortex D2 receptors during adolescence promotes subsequent reductions in dopamine activityPMID:24271009
Given the dose-dependent inhibitory effect of D2-ags on ovarian VEGF production reported herein, we infer that current OHSS therapies used in humans may be improved by increasing the intraovarian concentration of D2-ags in these patients.PMID:25217874
In PC-12 cells, released dopamine triggers a delayed Ca2 + release via a dopamine receptor D2.PMID:24055909
It may play an important role in modulating oxidative stress and inflammation in the substantia nigra and striatum via the RAS, which is impaired by aging.PMID:24529758
suppressive effect of perifornical lateral hypothalamus D2 receptor on EtOH drinkingPMID:24236888
results show that DA receptor inactivation causes dramatically different behavioral effects in preweanling and adult rats, thus providing additional evidence that the D2 receptor system is not functionally mature by the end of the preweanling periodPMID:24057816
Dopamine D2 receptor expression is decreased in the brainstem of animals fed high-fat high-sugar diets.PMID:24262750
We conclude that a diurnal change of D2R mRNA expression in MBH may underlie the diurnal rhythms of TIDA neuron activity and PRL secretion in OVX+E2 rats.PMID:24884386
DDR2 binding and activation were disrupted by collagen glycation, pointing to a mechanism for the diminished levels of lysyl oxidase and consequently low lysyl oxidase-derived cross-links in diabetic bone.PMID:24120383
The time course of Drd2- and noradrenaline receptor-mediated transmission reflects underlying differences in the extent of spillover and pooling of inhibitory postsynaptic potentials (IPSPs).PMID:24872568
Individual differences in D2 dopamine receptor sensitivity may be predictive of cocaine sensitivity and reward.PMID:24223783
The cardiac sympathoinhibition induced by 3 mug kg(-1) min(-1) quinpirole involves the dopamine D2 receptor subtype.PMID:24032529
[Isoform Long]: Expressed in the anterior lobe of the pituitary gland. Expressed ventral tegmental area of the midbrain and the pars compacta of the substantia nigra. Expressed seven times more than isoform short in the caudate nucleus.; [Isoform Short]: