MSHSPARQHLVESSRMDVVDSLLMNGSNITPPCELGLENETLFCLDQPQPSKEWQSALQI LLYSIIFLLSVLGNTLVITVLIRNKRMRTVTNIFLLSLAVSDLMLCLFCMPFNLIPNLLK DFIFGSAVCKTTTYFMGTSVSVSTFNLVAISLERYGAICRPLQSRVWQTKSHALKVIAAT WCLSFTIMTPYPIYSNLVPFTKNNNQTANMCRFLLPSDAMQQSWQTFLLLILFLLPGIVM VVAYGLISLELYQGIKFDASQKKSAKEKKPSTGSSTRYEDSDGCYLQKSRPPRKLELQQL SSGSGGSRLNRIRSSSSAANLIAKKRVIRMLIVIVVLFFLCWMPIFSANAWRAYDTVSAE KHLSGTPISFILLLSYTSSCVNPIIYCFMNKRFRLGFMATFPCCPNPGPPGVRGEVGEEE DGRTIRALLSRYSYSHMSTSAPPP
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Receptor for cholecystokinin. Mediates pancreatic growth and enzyme secretion, smooth muscle contraction of the gall bladder and stomach. Has a 1000-fold higher affinity for CCK rather than for gastrin. It modulates feeding and dopamine-induced behavior in the central and peripheral nervous system. This receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system.
Gene References into Functions
This study demonistrated that Cckar and Melanin-concentrating hormone colization in neuron in the lateral hypothalamus (LH) and zona incerta (ZI), but MCHR1 mRNA is widely expressed throughout the brain.PMID:24978951
Data suggest that Apo AIV (apolipoprotein AIV) in NTS (nucleus of the solitary tract) or/and peripheral Cck (cholecystokinin) require vagal Cck1r/Cckar signaling to elicit satiation; high-fat diet reduces satiating capacity of these signals.PMID:24564397
factors secondary to obesity and/or diabetes rather than impaired CCK-1 receptor signaling may contribute to altered CART expressionPMID:23545074
CCK-A receptors are located on the cell bodies of cholinergic interneurons in the corpus striatum.PMID:22981453
Activation of duodenal PKC-delta leads to the stimulation of CCK release and activation of the CCK-A receptor signaling axis to lower glucose production in normal rats.PMID:21984583
Data indicate that the Homo-Phe derivative 2 (VL-0797) enhanced 12-fold the affinity for the rat CCK(1)-R affinity and 15-fold for the human CCK(1)-R relative to the reference compound 12 (VL-0395).PMID:21728335
Data suggest L-364,718 potentiates electroacupuncture analgesia through the CCK-A receptor of pain-excited and pain-inhibited neurons in the nucleus parafascicularis.PMID:20953702
CCK1 and CCK2 receptors are expressed on pancreatic stellate cells and induce collagen productionPMID:20843811
our results demonstrate for the first time, that CCK-1 receptor plays a crucial role in both meal-induced and fasting insulin sensitizationPMID:20624386
Present study examined the contribution of genetics, sex and early maternal environment to anxiety-like behaviors and locomotion in CCK1 knockout rats, suggesting that the mutation may predispose (rather than induce) the animals to an anxious phenotype.PMID:20347877
The results of this study showed that increased oil intake in cck-1 receptor deficient rats is driven by both peripheral deficits to satiation and altered orosensory sensitivity.PMID:19887078
Gastric leptin may exert acute sympathoinhibitory and cardiovascular effects via vagal transmission and CCK(1) receptor activation and may play a separate role to adipose leptin in short-term cardiovascular regulation.PMID:19940076
Activation of high-affinity CCK(A) receptors elicits Ca(2+) oscillations, whereas stimulation of low-affinity CCK(A) receptors evokes a sustained Ca(2+) plateau; these modes are mediated through L-type Ca(2+) channel and involve G(q) protein.PMID:12016125
These results indicate that CCKB, but not CCKA receptors are involved in anxiety, as tested by microinjection of cholecystokinin agonists.PMID:12373548
endogenous CCK appears to act in part by a paracrine or neurocrine mechanism at CCKARs peripheral to the blood-brain barrier to inhibit gastric emptyingPMID:12388446
Endogenous CCK appears to act in part at CCKARs peripheral to the blood-brain barrier to inhibit food intakePMID:12414437
None of the three known phases of the febrile response of rats to lipopolysaccharides requires the CCK-A receptor.PMID:12562931
results demonstrate that cholecystokinin stimulates tyrosine phosphorylation of three sites in focal adhesion kinase and proline-rich kinase 2 but differs in participation of cholecystokinin receptor A and by protein kinase C and [Ca2+]PMID:12651850
CCK-AR and CCK-BR gene were present in pulmonary vascular endothelial cells, macrophages, bronchial epithelial cells and alveolar epithelial cells, which play an important role in mediating the regulatory actions of CCK-8 on these cells.PMID:12800239
peripheral and central responses to enterostatin are mediated through or dependent on peripheral and central CCK-A receptorsPMID:12855414
CCK-A receptors play an important role in the regulation of central dopamine transmission, as revealed by studies of the CCK-A receptor-deficient Otsuka Long Evans Tokushima Fatty (OTLEF) rat strain.PMID:12932815
spatial memory was impaired in the OLETF rats with genetic abnormality in cck-a receptorPMID:14607104
the data identified CCK-A and CCK-B receptor mRNAs in the rat retina and demonstrated that they are functional, stimulating tyrosine phosphorylation pathways.PMID:14698681
involvement of type A CCK receptors in the mediation of the inhibitory effect of large doses of ethanol on the gastric emptyingPMID:14700745
acute pancreatitis induced by bile-pancreatic duct ligation associates with a temporal increase in pancreatic cholecystokinin-A receptor protein expression, p38 mitogen activated protein kinase activation, and nuclear factor-kappaB activationPMID:14988658
apo A-IV released from the intestinal mucosa during lipid absorption stimulates the release of endogenous CCK that activates CCK(1) receptors on vagal afferent nerve terminals initiating feedback inhibition of gastric motility.PMID:15117731
Differential roles for cholecystokinin a receptors in energy balance in rats and mice.PMID:15123537
The OLETF rats showed a large hysteresis.PMID:15178543
Taste preference in Otsuka Long-Evans Tokushima fatty (OLETF) rats with deficiency of this receptor.PMID:15358606
These findings demonstrate that compared with controls, OLETF rats differ in their gustatory functions with an overall augmented sensitivity for sweet that progresses during prediabetes.PMID:16081877
Lack of CCK-1 receptors, or other OLETF-related abnormalities, resulted in a satiation deficit, leading to increased meal size, hyperphagia, and increased weight gain as early as 2-4 postnatal days.PMID:16099824
Cholecystokinin-8 activates the brainstem and myenteric neurons through the CCK1 receptor.PMID:16112401
CCK1 receptors have a role in stress and pain responses in ratsPMID:16289472
under 'basal' conditions, a portion of the glandular protein synthesis, as well as the whole increase in synthesis in response to administration of pentagastrin, engaged both types of CCK receptors.PMID:16556659
OLETF rats do not express deficits in controlling gastric emptying rates; however, they exhibit decreased behavioral and vagal responsiveness to gastric distension that may contribute to the increased meal size in these animals.PMID:16728725
REVIEW: hyperphagia and obesity in OLETF rats without CCK-1 receptorsPMID:16815799
Report effects of cholecystokinin-58 on type 1 cholecystokinin receptor function and regulation.PMID:18776046
cholecystokinin CCK1 and serotonin 5-HT3 receptors are mediators of the excitatory effects of cholecystokinin and 5-HT, respectively, on pancreatic vagal afferent dischargePMID:19026634
Fischer 344 rats lacking the cholecystokinin-1 receptor gene show normal feeding and body weight.PMID:19111529
The findings suggest that in addition to previously described deficits in peripheral satiety signals and augmented orexigenic regulation, the anorectic effect of CART peptide may also be diminished in CCK-1 deficient rats.PMID:19533109
endogenous CCK-1 receptor signaling in infants is a potential pathway through which maternal-pup interactions regulate the development and functional organization of emotional circuits that control anxiety-like behavior in the offspring.PMID:20001102
Show
More
Hide
All
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Pancreas and brain. Also expressed in the gastrointestinal system and vagus nerve.