AEAHQAVAFQFTVTPDGIDLRLSHEALKQICLSGLHSWKKKFIRFKNGIITGVFPANPSS WLIVVVGVISSMHAKVDPSLGMIAKISRTLDTTGRMSSQTKNIVSGVLFGTGLWVAVIMT MRYSLKVLLSYHGWMFAEHGKMSRSTKIWMAMVKVLSGRKPMLYSFQTSLPRLPVPAVKD TVSRYLESVRPLMKEEDFQRMTALAQDFAVNLGPKLQWYLKLKSWWATNYVSDWWEEYIY LRGRGPLMVNSNYYAMEMLYITPTHIQAARAGNTIHAILLYRRTLDREELKPIRLLGSTI PLCSAQWERLFNTSRIPGEETDTIQHIKDSRHIVVYHRGRYFKVWLYHDGRLLRPRELEQ QMQQILDDPSEPQPGEAKLAALTAADRVPWAKCRQTYFARGKNKQSLDAVEKAAFFVTLD ESEQGYREEDPEASIDSYAKSLLHGRCFDRWFDKSITFVVFKNSKIGINAEHSWADAPVV GHLWEYVMATDVFQLGYSEDGHCKGDTNPNIPKPTRLQWDIPGECQEVIDASLSSASLLA NDVDLHSFPFDSFGKGLIKKCRTSPDAFIQLALQLAHYKDMGKFCLTYEASMTRLFREGR TETVRSCTMESCNFVQAMMDPKSTAEQRLKLFKIACEKHQHLYRLAMTGAGIDRHLFCLY VVSKYLAVDSPFLKEVLSEPWRLSTSQTPQQQVELFDFEKNPDYVSCGGGFGPVADDGYG VSYIIVGENFIHFHISSKFSSPETDSHRFGKHLRQAMMDIITLFGLTINSKK
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Catalyzes the transfer of the acyl group of long-chain fatty acid-CoA conjugates onto carnitine, an essential step for the mitochondrial uptake of long-chain fatty acids and their subsequent beta-oxidation in the mitochondrion. Plays an important role in hepatic triglyceride metabolism.
Gene References into Functions
Obesity-alleviating potential of asiatic acid and its effects on ACC1, UCP2, and CPT1 mRNA expression in high fat diet-induced obese Sprague-Dawley ratsPMID:28993954
Furthermore, given the already low abundance of Cpt1b in white adipose tissue, it is unlikely that decreases in its expression can quantitatively decrease whole body energy expenditure enough to contribute to an obese phenotype.PMID:28330968
e found that CPT1AM-expressing rBA have increased FAO, lipolysis, UCP1 protein levels and mitochondrial activity. Additionally, enhanced FAO reduced the palmitate-induced increase in triglyceride content and the expression of obese and inflammatory markers. Thus, CPT1AM-expressing rBA had enhanced fat-burning capacity and improved lipid-induced derangements.PMID:27438137
upregulation CPT1 expression leading to reduction in the accumulation of lipid intermediates in skeletal muscle.PMID:23815800
CPT-1 activity was altered in concert with fasting and refeeding states, supporting a physiological role of CPT-1a in mediating the control of feedingPMID:23736540
The implications are that L-CPT1 expression induces metabolic remodeling hypertrophic signaling and that regulatory factors beyond malonyl CoA in the heart regulate long chain fatty acid oxidation via L-CPT1.PMID:22982985
The hypolipidemic effect produced by donkey's milk paralleled with the enhanced mitochondrial activity/proton leakage and with the increased activity or expression of mitochondrial markers namely, carnitine palmitoyl transferase and uncoupling protein 2.PMID:22930490
-L-carnitine supplementation reverses the age-related decline in carnitine palmitoyltransferase 1 (CPT1) activity in interfibrillar mitochondria without changing the L-carnitine content in the rat heartPMID:22322067
sequence-dependence of oligomerization of transmembrane domain 2 of carnitine palmitoyltransferase 1A (CPT1A), to elucidate the role of this domain in the function of the full-length enzymePMID:21917985
an environment-dependent structural switch underlies the regulation of carnitine palmitoyltransferase 1APMID:21990363
The goal of the present study was to achieve more understanding on the modification/s of carnitinepalmitoyltransferase-I (CPT-I), the rate-limiting enzyme of the mitochondrial fatty acid beta-oxidation, during steatohepatitis.PMID:21909411
Acyl-CoA binding proteins interact with the acyl-CoA binding domain of mitochondrial carnitine palmitoyl transferase IPMID:21541677
strong protein-protein interaction between CPT1a, long chain acyl-CoA synthetase, and voltage-dependent anion channelPMID:21622568
pig and rat L-CPTI have different malonyl-CoA sensitivity, because the first 18 N-terminal amino acid residues interact differently with the C-terminal domainPMID:11790778
Adenovirus-mediated overexpression of liver carnitine palmitoyltransferase I in INS1E cells: effects on cell metabolism and insulin secretion.PMID:11988095
the last 31 C-terminal residues constitute a secondary structural determinant essential for the initial protein folding of L-CPTIPMID:12351641
L-CPT1 is not targeted to the endoplasmic reticulum membrane and that malonyl-CoA chloramphenicol acetyltransferase in microsomal fractions is L-CPT1 that is derived from mitochondria, possibly from membrane contact sitesPMID:12401113
rat liver carnitine palmitoyltransferase has conserved residues essential for malonyl-CoA inhibitionPMID:12499375
identification of conserved arginine and glutamate residues in C-terminal domain tha are improtant for catalytic activity and malonyl-CoA sensitivityPMID:12540837
Data show that either genetic or biochemical inhibition of hypothalamic carnitine palmitoyltransferase-1 activity was sufficient to substantially diminish food intake and endogenous glucose production.PMID:12754501
rat liver carnitine palmitoyltransferase I and its muscle isoform have similar malonyl-CoA sensitivity due to a single amino acid in the C-terminal domain of CPTIPMID:12826662
structural model for L-CPT I (liver CPT I), based on the similarity of this enzyme to the recently crystallized mouse carnitine acetyltransferasePMID:14711372
kinetic study of rat liver mitochondrial carnitine palmitoyltransferase-IPMID:15247243
mRNA steady-state levels of CPT I and mit HMG-CoA are not changed in rat DMBA-induced mammary cancerPMID:15254779
peroxisomal proliferator-activated receptor-gamma coactivator-1(PGC-1)alpha participates in stimulation of Carnitine palmitoyltransferase I (CPT-I) alpha gene expression by thyroid hormone suggesting that PGC-1 alpha is a thyroid hormone coactivatorPMID:15469941
long-chain fatty acids regulate L-CPT I transcription through a PPARalpha-independent pathway, at least in hepatoma cellsPMID:16177188
sequence spanning the loop-transmembrane (TM)2 boundary determines the disposition of this TM in the membrane so as to alter the conformation of the C-terminal segment and thus affect its interaction with malonyl-CoAPMID:16908527
LCPT I overexpression protects L6E9 myotubes from fatty acid-induced insulin resistance.PMID:17062841
These results demonstrate that PGC-1beta is a coactivator in the T3 induction of CPT-Ialpha and that PGC-1beta has similarities and differences with the PGC-1alpha isoformPMID:17239528
oligomeric structure of CPT1A would allow the newly formed acylcarnitines to gain direct access into the intermembrane space, hence facilitating substrate channeling.PMID:17650509
interventions that increase CPT1a activity could have potential benefits in the treatment of nonalcoholic fatty liver diseasePMID:18349115
Accumulation of 3-hydroxylated intermediates of long-chain fatty acids may contribute to the pathogenesis of retinopathy in MTP deficiencies.PMID:18385088
Regulated over-expression of CPT1 is beneficial for glucolipotoxic beta-cells.PMID:18706397
A high-fat diet produces, but insulin resistance in the sham-treated muscle, insulin action is improved in the CPT1-overexpressing muscle in rats.PMID:19073774
molecular modeling of rCPT1A TM2 highlighted the favorable orientation of GXXXG and GXXXA motifs in the formation of the TM2 hexamer.PMID:19136561
Study highlights that CPT1A is a prime target to increase hepatic LCFA beta-oxidation and that acting directly on the degree of its malonyl-CoA sensitivity may be a relevant strategy to prevent and/or correct hepatic steatosis.PMID:19302064