Home
Product
Protein
Transmembrane Proteins
Recombinant Rat C5a anaphylatoxin chemotactic receptor (C5ar1)

Recombinant Rat C5a anaphylatoxin chemotactic receptor (C5ar1)

Code: CSB-CF003996RA

Rate （N/A）
Review （0）

Size:

20μg100μg

US$5128

Quantity:

Express system: in vitro E.coli expression system

Species: Rattus norvegicus (Rat)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

C5ar1

Uniprot NO.

P97520

Alternative Names

C5ar1; C5r1; C5a anaphylatoxin chemotactic receptor 1; C5a anaphylatoxin chemotactic receptor; C5a-R; C5aR; CD antigen CD88

Species

Rattus norvegicus (Rat)

Source

in vitro E.coli expression system

Expression Region

1-352

Target Protein Sequence

MDPISNDSSEITYDYSDGTPNPDMPADGVYIPKMEPGDIAALIIYLAVFLVGVTGNALVV WVTAFEAKRTVNAIWFLNLAVADLLSCLALPILFTSIVKHNHWPFGDQACIVLPSLILLN MYSSILLLATISADRFLLVFKPIWCQKFRRPGLAWMACGVTWVLALLLTIPSFVFRRIHK DPYSDSILCNIDYSKGPFFIEKAIAILRLMVGFVLPLLTLNICYTFLLIRTWSRKATRST KTLKVVMAVVTCFFVFWLPYQVTGVILAWLPRSSSTFQSVERLNSLCVSLAYINCCVNPI IYVMAGQGFHGRLRRSLPSIIRNVLSEDSLGRDSKSFTRSTMDTSTQKSQAV
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Receptor for the chemotactic and inflammatory peptide anaphylatoxin C5a. The ligand interacts with at least two sites on the receptor: a high-affinity site on the extracellular N-terminus, and a second site in the transmembrane region which activates downstream signaling events. Receptor activation stimulates chemotaxis, granule enzyme release, intracellular calcium release and superoxide anion production.

Gene References into Functions

The C5aR expression was upregulated and localized to neurons and microglia in spinal cord ischemia reperfusion injury in the rat. PMID:25917954
C5aR is critically involved in ventricular remodeling by regulating inflammatory responses in the hypertensive heart. PMID:21753735
present in bone forming osteoblasts and bone resorbing osteoclasts, suggesting role in fracture healing PMID:21460748
These results demonstrate that CD88 is expressed on presynaptic terminals of mossy fibres within the CA3 region of the hippocampus. PMID:19917081
Our findings demonstrate that C5a may have a role in the activation of the HPA axis in response to systemic LPS. PMID:17703884
Role of C5ar1 in the development of the rat cerebellum is reported. PMID:18635264
C5a receptors and C5L2 were demonstrated in the rat anterior pituitary gland and they may play a role in dampening down inflammation by inhibiting the release of MIF and stimulating the release of ACTH. PMID:19020281