Recombinant Rat C-X-C chemokine receptor type 4 (Cxcr4)

Code: CSB-CF006254RA
Size:
20μg
20μg100μg
US$5106
Quantity:
Express system: in vitro E.coli expression system
Species: Rattus norvegicus (Rat)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
Cxcr4
Uniprot NO.
Species
Rattus norvegicus (Rat)
Source
in vitro E.coli expression system
Expression Region
1-349
Target Protein Sequence
MEIYTSDNYSEEVGSGDYDSNKEPCFRDENENFNRIFLPTIYFIIFLTGIVGNGLVILVM GYQKKLRSMTDKYRLHLSVADLLFVITLPFWAVDAMADWYFGKFLCKAVHIIYTVNLYSS VLILAFISLDRYLAIVHATNSQSARKLLAEKAVYVGVWIPALLLTIPDIIFADVSQGDGR YICDRLYPDSLWMVVFQFQHIMVGLILPGIVILSCYCIIISKLSHSKGHQKRKALKTTVI LILAFFACWLPYYVGISIDSFILLEVIKQGCEFESVVHKWISITEALAFFHCCLNPILYA FLGAKFKSSAQHALNSMSRGSSLKILSKGKRGGHSSVSTESESSSFHSS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Receptor for the C-X-C chemokine CXCL12/SDF-1 that transduces a signal by increasing intracellular calcium ion levels and enhancing MAPK1/MAPK3 activation. Involved in the AKT signaling cascade. Plays a role in regulation of cell migration, e.g. during wound healing. Acts as a receptor for extracellular ubiquitin; leading to enhanced intracellular calcium ions and reduced cellular cAMP levels. Binds bacterial lipopolysaccharide (LPS) et mediates LPS-induced inflammatory response, including TNF secretion by monocytes. Involved in hematopoiesis and in cardiac ventricular septum formation. Also plays an essential role in vascularization of the gastrointestinal tract, probably by regulating vascular branching and/or remodeling processes in endothelial cells. Involved in cerebellar development. In the CNS, could mediate hippocampal-neuron survival.
Gene References into Functions
  1. suggest that ubiquitin (UB) interacts with CXCR4, and UB/CXCR4 interaction affects intracellular signaling, and modulates fibroblast phenotype and function PMID:30195032
  2. Study demonstrated that the elevated expression of CXCR4 and relative serum levels in renal tubular epithelial cells were correlated with the severity of renal ischemia reperfusion injury. PMID:29073721
  3. These results suggest that modification of Bone marrow-derived mesenchymal stem cells by dual expression of CXCR4 and IL-35 may provide an effective therapeutic strategy for inflammatory bowel disease. PMID:29524405
  4. Suppression of miR-210 attenuated hypoxia-induced cell injury in H9c2 cells by targeting CXCR4, along with activations of the SMAD and mTOR signaling pathways. PMID:29710553
  5. The aim of the present study was to assess whether fibrosis markers, estrogen receptor (ER)alpha and the stromal derived factor (SDF)1/CXC chemokine receptor type 4 (CXCR4) axis are abnormally expressed in Intrauterine adhesions endometrium. PMID:29568895
  6. Both bone marrow-derived endothelial progenitor cells and gastric endothelial cells express SDF-1 and CXCR4, which indicates direct paracrine interactions between these cells during neovascularization. PMID:29550796
  7. the lower expression levels of CXCR4 and p-AKT may be responsible for the impaired osteogenic ability and lower chemotactic activity towards SDF-1alpha of OVX-bone marrow mesenchymal stem cells . PMID:29207050
  8. The SDF-1alpha/CXCR4 axis drives proliferation and hypertrophy of and collagen production by CFs, PGVSMCs, and GMCs, particularly in cells from genetically hypertensive animals and when DPP4 is inhibited. PMID:29114002
  9. CXC chemokine receptor type 4 antagonism alleviated renal interstitial fibrosis in long-term surviving kidney allografts by down-regulating expression of transforming growth factor beta1. PMID:28585910
  10. Gene expression and localization of SDF-1 and CXCR4 was altered during fracture healing, which may contribute to the impaired fracture healing in DM. PMID:28412763
  11. Data show that miR-338 exerts significant influence in the inhibition of morphine tolerance by suppressing CXCR4 in bone cancer pain (BCP). PMID:28108674
  12. Study provided behavioral and morphological evidence that enriched environment (EE) was beneficial for neurological outcomes and that these effects might be mediated through SDF-1/CXCR4 pathway during the chronic stage of lobe epilepsy. These results revealed that although CXCR4 antagonist AMD3100 reversed the proliferation of neurogenesis, it did not abolish the cognitive improvement induced by EE. PMID:28104461
  13. Our findings suggest that NRF-1 regulates the expression of CXCR4 in normal retinal development and in pathologic processes of retinal hypoxia and neovascularization. PMID:28903152
  14. simulated microgravity disrupts cytoskeleton organization and increases apoptosis of rat Neural crest stem cells via upregulating CXCR4 expression and the RhoA-ROCK1-p38 MAPK-p53 signaling pathway. PMID:27269634
  15. SDF1-CXCR4 signaling mediates the transition from acute pain to chronic pain state. PMID:27011380
  16. CXCR4 overexpression can mobilize mesenchymal stem cells into ischemic area, whereby these cells can promoted angiogenesis and alleviate left ventricular remodeling remodeling via paracrine signaling mechanism. PMID:28233339
  17. regulatory activity of molecular regulators of SDF-1alpha/CXCR4 on neural stem cell migration PMID:26886751
  18. Satellite glial cells-neuronal cross-talk in hyperalgesia is mediated by SDF1-CXCR4 coupling. PMID:26597700
  19. Enhances the anti-apoptotic effects of the BMSCs by upregulating the expression of SDF-1/CXCR4 axis. PMID:26398409
  20. SDF-1/CXCR4 pathway seems to be involved in the enhancement of neurogenesis and behavioral recovery induced by post-stroke forced limb-use PMID:26444377
  21. The CXCL12/CXCR4/PI3K/pAkt signalling pathway increased progesterone-induced endothelial progenitor cells viability. PMID:26818151
  22. The expression of CXCR4 is increased in the cochlea in newborn animals following auditory stimulation. PMID:26164455
  23. CXCR4 antagonism decreases lung inflammation and improves alveolar and vascular structure in neonatal rats with experimental bronchopulmonary dysplasia (BPD). PMID:25825119
  24. This study examines the role of CXCR4 in cardiomyocyte response to ischaemia-reperfusion (I/R) injury. PMID:25824297
  25. This study demonstrated a potentially reno-protective role for CXCR4 in diabetes that is impeded in its actions in the human kidney by the coincident up-regulation of ligand-inactivating endopeptidases. PMID:25549045
  26. CXCR4 receptor overexpression in mesenchymal stem cells has a role in treatment of acute lung injury in rats PMID:25492872
  27. Stromal-derived factor -1/CXCR4 can enhance the migration of bone marrow mesenchymal stem cells in vitro in a rat abdominal aortic aneurysm model. PMID:24751384
  28. Findings indicate that CXCR-4 and -7 receptors were co-expressed in BMSCs and synergistically promoted BMSC migration. PMID:24924806
  29. CXCR4 inhibition ameliorates severe obliterative pulmonary hypertension and accumulation of C-kit cells in rats. PMID:24587052
  30. Results suggest that endogenous endothelial progenitor cells (EPCs) participated in the neovascularization via CXCR4/SDF-1 axis after permanent middle cerebral artery occlusion and mobilizing endogenous EPCs could be a treatment alternative for stroke PMID:24581269
  31. Local SDF-1/CXCR4 signaling functions to preserve microvascular integrity and prevent renal fibrosis. PMID:24637920
  32. The SDF-1/CXCR4 axis regulates migration of transplanted bone marrow mesenchymal stem cells towards the pancreas in rats with acute pancreatitis. PMID:24626964
  33. Over-expression CXCR4 leads to enhanced in vivo mobilization and engraftment of bone marrow-derived mesenchymal stem cells into inflamed colon. PMID:24122226
  34. CXCR4 activation with SDF-1alpha and ubiquitin results in partially synergistic effects on cellular signaling. PMID:24373940
  35. Migration and survival of ASCs could be improved by atorvastatin under ischemia-reperfusion injury, which were ascribed to SDF-1alpha/CXCR-4 axis. PMID:24312447
  36. Mechanical allodynia is suppressed by inhibition of the CXCR4/SDF1-alpha system. PMID:24557113
  37. CXCR4 and CXCR7 form a functional receptor unit in microglial cells, which is up-regulated during activation of microglia both in vitro and in vivo. PMID:23289420
  38. following optic nerve crush, the levels of endogenous SDF-1alpha and CXCR4 increase in the retina and optic nerve, where activated glial cells may act as a source of increased SDF-1alpha protein. PMID:23832528
  39. A positive correlation between microvessel density and the high expression of SDF1 and CXCR4 following hyperbaric oxygen treatment. PMID:23969990
  40. Data indicate that Rehmannia glutinosa extract up-regulated the expression of angiogenesis-associated ligand/receptor, including CD133, VEGFR2 and SDF-1alpha/CXCR4. PMID:23349848
  41. Evidence that the CXCL12/CXCR4 system is involved in modulation of nociceptive signalling. PMID:22694179
  42. These findings indicate that the activation of CXCR4 may promote tracheal cell proliferation and migration to the sites of airway injury where SDF-1 is regulated. PMID:23576796
  43. positive impact of Sdf-1 on muscle regeneration is related to the mobilisation of endogenous cells, that is satellite cells and myoblasts, as well as non-muscle stem cells, expressing Cxcr4 and CD34. PMID:22978573
  44. Heparin oligosaccharides inhibit chemokine (CXC motif) ligand 12 (CXCL12) cardioprotection by binding orthogonal to the dimerization interface, promoting oligomerization, and competing with the chemokine (CXC motif) receptor 4 (CXCR4) N terminus PMID:23148226
  45. Increased expression of CXCR4 in allograft mesenchymal stem cells is critical for myocardial neovascularization in rats with myocardial infarction. PMID:23029422
  46. CXCR4 played a crucial role in the intimal hyperplasia after carotid artery injury, and restenosis may have be attenuated after inhibition of CD34(+)CXCR4(+) cells in the intima. PMID:22159319
  47. CXCR4 overexpression in mesenchymal stem cells promotes their mobilization and enhanced neuroprotection in a rat cerebral ischemia model. PMID:22280945
  48. CXCR4 is upregulated in a model of spatial learning and memory in trained rats indicating a positive correlation between CXCR4 expression and axonal sprouting. PMID:22140095
  49. Sal B also obviously down-regulated the SDF-1alpha-stimulated up-regulation of CXCR4. PMID:22166584
  50. Folliculostellate (FS) cells express chemokine CXCL12 and its receptor CXCR4. The CXCL12/CXCR4 axis evokes interconnection of FS cells. PMID:22355073

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction. Early endosome. Late endosome. Lysosome.
Protein Families
G-protein coupled receptor 1 family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products