MEIYTSDNYSEEVGSGDYDSNKEPCFRDENENFNRIFLPTIYFIIFLTGIVGNGLVILVM GYQKKLRSMTDKYRLHLSVADLLFVITLPFWAVDAMADWYFGKFLCKAVHIIYTVNLYSS VLILAFISLDRYLAIVHATNSQSARKLLAEKAVYVGVWIPALLLTIPDIIFADVSQGDGR YICDRLYPDSLWMVVFQFQHIMVGLILPGIVILSCYCIIISKLSHSKGHQKRKALKTTVI LILAFFACWLPYYVGISIDSFILLEVIKQGCEFESVVHKWISITEALAFFHCCLNPILYA FLGAKFKSSAQHALNSMSRGSSLKILSKGKRGGHSSVSTESESSSFHSS
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Receptor for the C-X-C chemokine CXCL12/SDF-1 that transduces a signal by increasing intracellular calcium ion levels and enhancing MAPK1/MAPK3 activation. Involved in the AKT signaling cascade. Plays a role in regulation of cell migration, e.g. during wound healing. Acts as a receptor for extracellular ubiquitin; leading to enhanced intracellular calcium ions and reduced cellular cAMP levels. Binds bacterial lipopolysaccharide (LPS) et mediates LPS-induced inflammatory response, including TNF secretion by monocytes. Involved in hematopoiesis and in cardiac ventricular septum formation. Also plays an essential role in vascularization of the gastrointestinal tract, probably by regulating vascular branching and/or remodeling processes in endothelial cells. Involved in cerebellar development. In the CNS, could mediate hippocampal-neuron survival.
Gene References into Functions
suggest that ubiquitin (UB) interacts with CXCR4, and UB/CXCR4 interaction affects intracellular signaling, and modulates fibroblast phenotype and functionPMID:30195032
Study demonstrated that the elevated expression of CXCR4 and relative serum levels in renal tubular epithelial cells were correlated with the severity of renal ischemia reperfusion injury.PMID:29073721
These results suggest that modification of Bone marrow-derived mesenchymal stem cells by dual expression of CXCR4 and IL-35 may provide an effective therapeutic strategy for inflammatory bowel disease.PMID:29524405
Suppression of miR-210 attenuated hypoxia-induced cell injury in H9c2 cells by targeting CXCR4, along with activations of the SMAD and mTOR signaling pathways.PMID:29710553
The aim of the present study was to assess whether fibrosis markers, estrogen receptor (ER)alpha and the stromal derived factor (SDF)1/CXC chemokine receptor type 4 (CXCR4) axis are abnormally expressed in Intrauterine adhesions endometrium.PMID:29568895
Both bone marrow-derived endothelial progenitor cells and gastric endothelial cells express SDF-1 and CXCR4, which indicates direct paracrine interactions between these cells during neovascularization.PMID:29550796
the lower expression levels of CXCR4 and p-AKT may be responsible for the impaired osteogenic ability and lower chemotactic activity towards SDF-1alpha of OVX-bone marrow mesenchymal stem cells .PMID:29207050
The SDF-1alpha/CXCR4 axis drives proliferation and hypertrophy of and collagen production by CFs, PGVSMCs, and GMCs, particularly in cells from genetically hypertensive animals and when DPP4 is inhibited.PMID:29114002
CXC chemokine receptor type 4 antagonism alleviated renal interstitial fibrosis in long-term surviving kidney allografts by down-regulating expression of transforming growth factor beta1.PMID:28585910
Gene expression and localization of SDF-1 and CXCR4 was altered during fracture healing, which may contribute to the impaired fracture healing in DM.PMID:28412763
Data show that miR-338 exerts significant influence in the inhibition of morphine tolerance by suppressing CXCR4 in bone cancer pain (BCP).PMID:28108674
Study provided behavioral and morphological evidence that enriched environment (EE) was beneficial for neurological outcomes and that these effects might be mediated through SDF-1/CXCR4 pathway during the chronic stage of lobe epilepsy. These results revealed that although CXCR4 antagonist AMD3100 reversed the proliferation of neurogenesis, it did not abolish the cognitive improvement induced by EE.PMID:28104461
Our findings suggest that NRF-1 regulates the expression of CXCR4 in normal retinal development and in pathologic processes of retinal hypoxia and neovascularization.PMID:28903152
simulated microgravity disrupts cytoskeleton organization and increases apoptosis of rat Neural crest stem cells via upregulating CXCR4 expression and the RhoA-ROCK1-p38 MAPK-p53 signaling pathway.PMID:27269634
SDF1-CXCR4 signaling mediates the transition from acute pain to chronic pain state.PMID:27011380
CXCR4 overexpression can mobilize mesenchymal stem cells into ischemic area, whereby these cells can promoted angiogenesis and alleviate left ventricular remodeling remodeling via paracrine signaling mechanism.PMID:28233339
regulatory activity of molecular regulators of SDF-1alpha/CXCR4 on neural stem cell migrationPMID:26886751
Satellite glial cells-neuronal cross-talk in hyperalgesia is mediated by SDF1-CXCR4 coupling.PMID:26597700
Enhances the anti-apoptotic effects of the BMSCs by upregulating the expression of SDF-1/CXCR4 axis.PMID:26398409
SDF-1/CXCR4 pathway seems to be involved in the enhancement of neurogenesis and behavioral recovery induced by post-stroke forced limb-usePMID:26444377
The CXCL12/CXCR4/PI3K/pAkt signalling pathway increased progesterone-induced endothelial progenitor cells viability.PMID:26818151
The expression of CXCR4 is increased in the cochlea in newborn animals following auditory stimulation.PMID:26164455
CXCR4 antagonism decreases lung inflammation and improves alveolar and vascular structure in neonatal rats with experimental bronchopulmonary dysplasia (BPD).PMID:25825119
This study examines the role of CXCR4 in cardiomyocyte response to ischaemia-reperfusion (I/R) injury.PMID:25824297
This study demonstrated a potentially reno-protective role for CXCR4 in diabetes that is impeded in its actions in the human kidney by the coincident up-regulation of ligand-inactivating endopeptidases.PMID:25549045
CXCR4 receptor overexpression in mesenchymal stem cells has a role in treatment of acute lung injury in ratsPMID:25492872
Stromal-derived factor -1/CXCR4 can enhance the migration of bone marrow mesenchymal stem cells in vitro in a rat abdominal aortic aneurysm model.PMID:24751384
Findings indicate that CXCR-4 and -7 receptors were co-expressed in BMSCs and synergistically promoted BMSC migration.PMID:24924806
CXCR4 inhibition ameliorates severe obliterative pulmonary hypertension and accumulation of C-kit cells in rats.PMID:24587052
Results suggest that endogenous endothelial progenitor cells (EPCs) participated in the neovascularization via CXCR4/SDF-1 axis after permanent middle cerebral artery occlusion and mobilizing endogenous EPCs could be a treatment alternative for strokePMID:24581269
Local SDF-1/CXCR4 signaling functions to preserve microvascular integrity and prevent renal fibrosis.PMID:24637920
The SDF-1/CXCR4 axis regulates migration of transplanted bone marrow mesenchymal stem cells towards the pancreas in rats with acute pancreatitis.PMID:24626964
Over-expression CXCR4 leads to enhanced in vivo mobilization and engraftment of bone marrow-derived mesenchymal stem cells into inflamed colon.PMID:24122226
CXCR4 activation with SDF-1alpha and ubiquitin results in partially synergistic effects on cellular signaling.PMID:24373940
Migration and survival of ASCs could be improved by atorvastatin under ischemia-reperfusion injury, which were ascribed to SDF-1alpha/CXCR-4 axis.PMID:24312447
Mechanical allodynia is suppressed by inhibition of the CXCR4/SDF1-alpha system.PMID:24557113
CXCR4 and CXCR7 form a functional receptor unit in microglial cells, which is up-regulated during activation of microglia both in vitro and in vivo.PMID:23289420
following optic nerve crush, the levels of endogenous SDF-1alpha and CXCR4 increase in the retina and optic nerve, where activated glial cells may act as a source of increased SDF-1alpha protein.PMID:23832528
A positive correlation between microvessel density and the high expression of SDF1 and CXCR4 following hyperbaric oxygen treatment.PMID:23969990
Data indicate that Rehmannia glutinosa extract up-regulated the expression of angiogenesis-associated ligand/receptor, including CD133, VEGFR2 and SDF-1alpha/CXCR4.PMID:23349848
Evidence that the CXCL12/CXCR4 system is involved in modulation of nociceptive signalling.PMID:22694179
These findings indicate that the activation of CXCR4 may promote tracheal cell proliferation and migration to the sites of airway injury where SDF-1 is regulated.PMID:23576796
positive impact of Sdf-1 on muscle regeneration is related to the mobilisation of endogenous cells, that is satellite cells and myoblasts, as well as non-muscle stem cells, expressing Cxcr4 and CD34.PMID:22978573
Heparin oligosaccharides inhibit chemokine (CXC motif) ligand 12 (CXCL12) cardioprotection by binding orthogonal to the dimerization interface, promoting oligomerization, and competing with the chemokine (CXC motif) receptor 4 (CXCR4) N terminusPMID:23148226
Increased expression of CXCR4 in allograft mesenchymal stem cells is critical for myocardial neovascularization in rats with myocardial infarction.PMID:23029422
CXCR4 played a crucial role in the intimal hyperplasia after carotid artery injury, and restenosis may have be attenuated after inhibition of CD34(+)CXCR4(+) cells in the intima.PMID:22159319
CXCR4 overexpression in mesenchymal stem cells promotes their mobilization and enhanced neuroprotection in a rat cerebral ischemia model.PMID:22280945
CXCR4 is upregulated in a model of spatial learning and memory in trained rats indicating a positive correlation between CXCR4 expression and axonal sprouting.PMID:22140095
Sal B also obviously down-regulated the SDF-1alpha-stimulated up-regulation of CXCR4.PMID:22166584
Folliculostellate (FS) cells express chemokine CXCL12 and its receptor CXCR4. The CXCL12/CXCR4 axis evokes interconnection of FS cells.PMID:22355073
Show
More
Hide
All
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction. Early endosome. Late endosome. Lysosome.