Cxcr3; C-X-C chemokine receptor type 3; CXC-R3; CXCR-3; Interferon-inducible protein 10 receptor; IP-10 receptor; CD antigen CD183
Species
Rattus norvegicus (Rat)
Source
in vitro E.coli expression system
Expression Region
1-367
Target Protein Sequence
MYLEVSERQVLDASDIAFLLENSTSPYDYGENESDFSDSPPCPQDFSLNFDRTFLPVLYS LLFLLGLLGNGAVAAVLLSQRTALSSTDTFLLHLAVADVLLVLTLPLWAVDAAAQWVFGS GLCKVAGALFNINFYAGAFLLACISFDRYLSIVHATQIYRRDPWVRVALTCIVVWGLCVL FALPDFIFLSASHDQRLNATHCQYNFPQVGRTALRVLQLVAGFLMPLLVMAYCYAHILAV LLVSRGQRRFRAMRLVVVVVVAFAVCWTPYHLVVLVDILMDVGVLARNCGRESHVDVAKS VTSGMGYMHCCLNPLLYAFVGVKFKEQMWMLLMRLGRSDQRGPQRQPSSSRRESSWSETT EASYLGL
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Receptor for the C-X-C chemokine CXCL9, CXCL10 and CXCL11 and mediates the proliferation, survival and angiogenic activity of mesangial cells through a heterotrimeric G-protein signaling pathway. Binds to CCL21. Probably promotes cell chemotaxis response.
Gene References into Functions
chemokine CXCL10 promotes the development of experimental acute respiratory distress syndrome by binding to its receptor CXCR3PMID:28046003
the present study leads to an assumption that CXCL10/CXCR3 signaling mediates inhibition of the corticotropin-releasing factor-stimulated adrenocorticotropin-release by interferon-gamma.PMID:26572542
The chemokine CXCL12, its truncated form SDF-1(5-67), and the receptors CXCR4 and CXCR3 are expressed in human glaucomatous trabecular tissue and a human trabecular cell line.PMID:22675496
FK506 suppresses cell proliferation and effecter function, it has less effect on the expression of CCR5 and CXCR3 in lymphocytes.PMID:21515370
cellular distribution of fractalkine receptor CX3CR1 in the spinal circuit associated with nociceptive transmission supports a potential role in the mechanisms that contribute to the exaggerated pain state in models of neuropathy.PMID:15341587
Antagonised by various natural products, such as duramycin, roselipins and diosscin.PMID:15789559
CXCR3/IP-10 signaling is associated with the pathogenesis of experimental autoimmune myasthenia gravis.PMID:15843529
A novel mechanism is revealed by which CXCR3-expressing CD4 T cells mediate innate immune function that leads to hepatocellular damage during liver ischemia-reperfusion injury.PMID:16670343
CXCR3 is up-regulated in ischemia-reperfusion injury of liver in rats.PMID:18589091