Cxcr2; Il8rb; C-X-C chemokine receptor type 2; CXC-R2; CXCR-2; GRO/MGSA receptor; High affinity interleukin-8 receptor B; IL-8R B; CD antigen CD182
Species
Rattus norvegicus (Rat)
Source
in vitro E.coli expression system
Expression Region
1-359
Target Protein Sequence
MGEIRVDNFSLEDFFSGDIDSYNYSSDPPFTLSDAAPCPSANLDINRYAVVVIYVLVTLL SLVGNSLVMLVILYNRSTCSVTDVYLLNLAIADLFFALTLPVWAASKVNGWIFGSFLCKV FSFLQEITFYSSVLLLACISMDRYLAIVHATSTLIQKRHLVKFVCITMWFLSLVLSLPIF ILRTTVKANPSTVVCYENIGNNTSKWRVVLRILPQTYGFLLPLLIMLFCYGFTLRTLFKA HMGQKHRAMRVIFAVVLVFLLCWLPYNIVLFTDTLMRTKLIKETCERQNEINKALEATEI LGFLHSCLNPIIYAFIGQKFRHGLLKIMANYGLVSKEFLAKEGRPSFVGSSSANTSTTL
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Receptor for interleukin-8 which is a powerful neutrophil chemotactic factor. Binding of IL-8 to the receptor causes activation of neutrophils. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system. Binds to IL-8 with high affinity. Also binds with high affinity to CXCL3, GRO/MGSA and NAP-2.
Gene References into Functions
These data are concomitant with abnormal cerebral CXCL1/CXCR2 expression, and support temporal aberrations in CXCL1/CXCR2 and neutrophil dynamics in the placental-fetal-brain axis following chorioamnionitisPMID:29117499
The mRNA and protein levels of CXCR2 were significantly increased in the pulmonary tissue in a rat model of hepatopulmonary syndrome.PMID:27879294
Findings indicated that up-regulation of CXCL1 and CXCR2 might contribute to remifentanil-induce hypernociception via modulating spinal NR2B-containing NMDA receptor expression and phosphorylation in rats.PMID:26724371
GRK6 might be a key molecular involved in peripheral mechanism of neuropathic pain and that overexpression of GRK6 might be a potential strategy for treatment for neuropathic pain through inhibition of CXCR2 signal pathway.PMID:27145805
Findings indicate that acupuncture can increase the number of implanted embryos in embryo implantation failure, which may be relevant with up-regulation the expression of CXCL8 receptors CXCR1 and CXCR2 in endometrium.PMID:24496685
These data suggests an important role for CXCR2 receptors in oral squamous cell carcinoma.PMID:21670971
IL8RA-endothelial cells (EC), IL8RB-EC, and IL8RA/IL8RB-EC treatment reduces neointima formation dramatically in carotid artery endothelial cells at 28 days after injury.PMID:22361324
Inhibition of CXCR1 and CXCR2 chemokine receptors is an effective anti-inflammatory and neuroprotective treatment after spinal cord injury.PMID:20877331
These data suggest that CXCR2 overexpression in peripheral T cells is intracerebral microglial TNF-alpha-dependent and TNF-alpha primes T cells transendothelial migration in Alzheimer's diseases.PMID:18462836
data show that TII alveolar epithelial cells produce three of the major proinflammatory CXC chemokines (GRO, CINC-2alpha, and MIP-2) and their cognate receptor CXCR2PMID:12829448
A specific CXCR2 antagonist, SB-332235, effectively inhibited cigarette smoke-induced neutrophilia in a dose-dependent manner.PMID:15516486
Neuronal CXCR2 immunoreactivity was detected in several brain areas, which rapidly but transiently downregulated upon trauma.PMID:16472549
These findings highlight the contribution of CXCR2 in the pathophysiology of adjuvant-induced polyarthritis (AIA)PMID:17891165
CXCR2 activation might directly contribute to motor neuron degenerationPMID:18391506
Results suggest that the CXCR2 and PI3Kgamma signaling pathway may represent a suitable target for the development of novel therapeutic strategies for human diseases characterized by vascular leakage.PMID:19255141