Home
Product
Protein
Transmembrane Proteins
Recombinant Rat C-X-C chemokine receptor type 1 (Cxcr1)

Recombinant Rat C-X-C chemokine receptor type 1 (Cxcr1)

Code: CSB-CF304062RA

Rate （N/A）
Review （0）

Size:

20μg100μg

US$5106

Quantity:

Express system: in vitro E.coli expression system

Species: Rattus norvegicus (Rat)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

Cxcr1

Uniprot NO.

P70612

Alternative Names

Cxcr1; Il8ra; C-X-C chemokine receptor type 1; CXC-R1; CXCR-1; High affinity interleukin-8 receptor A; IL-8R A; CD antigen CD181

Species

Rattus norvegicus (Rat)

Source

in vitro E.coli expression system

Expression Region

1-349

Target Protein Sequence

MAEAEYFIWIAPEGDFEEEFGNITRMLPTGEYFSPCKRVPMTNRQAVVVFYALVFLLSLL GNSLVMLVILYRRRTRSVTDVYVLNLAIADLLFSLTLPFLAVSKWKGWIFGTPLCKMVSL LKEVNFFSGILLLACISVDRYLAIVHATRTLTRKRYLVKFVCMGTWGLSLVLSLPFAIFR QAYKPYRSGTVCYEVLGEATADLRITLRGLSHIFGFLLPLFIMLVCYGLTLRTLFKAHMR QKRRAMWVIFAVVLVFLLCCLPYNLVLLSDTLLGAHLIQDTCERRNNIDQALYITEILGF SHSCLNPVIYAFVGQSFRHEFLKILANLVHKEVLTHHSASFRTSLTTIY
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Receptor to interleukin-8, which is a powerful neutrophils chemotactic factor. Binding of IL-8 to the receptor causes activation of neutrophils. This response is mediated via a G-protein that activate a phosphatidylinositol-calcium second messenger system.

Gene References into Functions

N-acetylated proline-glycine-proline induces premature senescence of nucleus pulposus cells through CXCR1-dependent DNA damage and Reactive Oxygen Species production which activates the p53-p21-Rb and p16-Rb pathways. PMID:27769935
may contribute to inflammation in experimental mesangioproliferative glomerulonephritis PMID:23336303
Inhibition of CXCR1 and CXCR2 chemokine receptors improves motor and autonomic neurological outcomes after spinal cord injury. PMID:20877331

Hide All

Subcellular Location

Cell membrane; Multi-pass membrane protein.

Protein Families

G-protein coupled receptor 1 family

Database Links

UNIGENE: Rn.138115

KEGG: rno:54258

STRING: 10116.ENSRNOP00000066188

Promotions