Recombinant Rat C-C chemokine receptor type 5 (Ccr5)

CSB-CF004844RA
Size:
20μg
20μg100μg
US$5143
Quantity:
Express system: in vitro E.coli expression system
Species: Rattus norvegicus (Rat)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Orders can only be placed from within the U.S.

Product Details

Target Names
Ccr5
Uniprot NO.
Species
Rattus norvegicus (Rat)
Source
in vitro E.coli expression system
Expression Region
1-354
Target Protein Sequence
MDFQGSIPTYIYDIDYSMSAPCQKVNVKQIAAQLLPPLYSLVFIFGFVGNMMVFLILISC KKLKSMTDIYLFNLAISDLLFLLTLPFWAHYAANEWVFGNIMCKLFTGIYHIGYFGGIFF IILLTIDRYLAIVHAVFAIKARTVNFGVITSVVTWVVAVFVSLPEIIFMRSQKEGSHYTC SPHFLHIQYRFWKHFQTLKMVILSLILPLLVMVICYSGILNTLFRCRNEKKRHRAVRLIF AIMIVYFLFWTPYNIVLLLTTFQEYFGLNNCSSSNRLDQAMQVTETLGMTHCCLNPVIYA FVGEKFRNYLSVFFRKHIVKRFCKHCSIFQQVNPDRVSSVYTRSTGEQEVSTGL
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Description

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function
Receptor for a number of inflammatory CC-chemokines including CCL3/MIP-1-alpha, CCL4/MIP-1-beta and RANTES and subsequently transduces a signal by increasing the intracellular calcium ion level. May play a role in the control of granulocytic lineage proliferation or differentiation. Participates in T-lymphocyte migration to the infection site by acting as a chemotactic receptor.
Gene References into Functions
  1. The data of this study demonstrated that CCR5 is correlated with up-regulation of the expression of ROCK2 and P-MLC2(Ser19) in the ischaemia cortex PMID:26983670
  2. Spinal CCR5 is up-regulated in a model of cancer-induced bone pain. PMID:27848062
  3. fatigue upregulates the level of ORM1, which in turn functions as an anti-fatigue protein to enhance muscle endurance via the CCR5 pathway. PMID:26740279
  4. Local electroporation of anti-CCR5 siRNA into the left inflamed joints could achieve the silencing of CCR5 gene and alleviate local inflammation just in the knee joint PMID:25300256
  5. Expression levels of CCR5 mRNA in the spinal cord are up-regulated after nerve injury. PMID:24589480
  6. Blocking CCR5 attenuates, while enhancing CCR5 aggravates myocardial ischemia-reperfusion injury through modulating inflammatory responses in rat heart. PMID:23456481
  7. Early and persistent up-regulation of CCL4/CCR5 signaling during epileptogenesis suggests that CCL4 signalling, rather than CCL2 signalling, could have a role in the epileptogenic process. PMID:22353418
  8. Decrease in CCR5 in circulating cells strongly protected from excitotoxin-induced seizures, blood-brain barrier leakage, CNS injury, and inflammation, and facilitated neurogenic repair. PMID:20940264
  9. CCR5 and CXCR4 are present on the resident testicular macrophages in the interstitial space PMID:11994538
  10. Down-regulation of constitutively expressed surface CCR5 levels by interleukin 1-beta in an insulin-producing model system implies receptor internalization for re-utilization or destruction, secretion or both. PMID:12004163
  11. CCR5 is phosphorylated at specific sites by protein kinase C and GPCR kinase PMID:12403770
  12. Cultured neural progenitor cells from the subventricular zone of adult rat brain express chemokine receptor CCR5. PMID:14732474
  13. CCR5 mediates recruitment of both infiltrating macrophages and resident microglia to sites of central nervous system inflammation. PMID:17484785

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products