Home
Product
Protein
Transmembrane Proteins
Recombinant Rat C-C chemokine receptor type 5 (Ccr5)

Recombinant Rat C-C chemokine receptor type 5 (Ccr5)

Code: CSB-CF004844RA

Rate （N/A）
Review （0）

Size:

20μg100μg

US$5143

Quantity:

Express system: in vitro E.coli expression system

Species: Rattus norvegicus (Rat)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

Ccr5

Uniprot NO.

O08556

Species

Rattus norvegicus (Rat)

Source

in vitro E.coli expression system

Expression Region

1-354

Target Protein Sequence

MDFQGSIPTYIYDIDYSMSAPCQKVNVKQIAAQLLPPLYSLVFIFGFVGNMMVFLILISC KKLKSMTDIYLFNLAISDLLFLLTLPFWAHYAANEWVFGNIMCKLFTGIYHIGYFGGIFF IILLTIDRYLAIVHAVFAIKARTVNFGVITSVVTWVVAVFVSLPEIIFMRSQKEGSHYTC SPHFLHIQYRFWKHFQTLKMVILSLILPLLVMVICYSGILNTLFRCRNEKKRHRAVRLIF AIMIVYFLFWTPYNIVLLLTTFQEYFGLNNCSSSNRLDQAMQVTETLGMTHCCLNPVIYA FVGEKFRNYLSVFFRKHIVKRFCKHCSIFQQVNPDRVSSVYTRSTGEQEVSTGL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Receptor for a number of inflammatory CC-chemokines including CCL3/MIP-1-alpha, CCL4/MIP-1-beta and RANTES and subsequently transduces a signal by increasing the intracellular calcium ion level. May play a role in the control of granulocytic lineage proliferation or differentiation. Participates in T-lymphocyte migration to the infection site by acting as a chemotactic receptor.

Gene References into Functions

The data of this study demonstrated that CCR5 is correlated with up-regulation of the expression of ROCK2 and P-MLC2(Ser19) in the ischaemia cortex PMID:26983670
Spinal CCR5 is up-regulated in a model of cancer-induced bone pain. PMID:27848062
fatigue upregulates the level of ORM1, which in turn functions as an anti-fatigue protein to enhance muscle endurance via the CCR5 pathway. PMID:26740279
Local electroporation of anti-CCR5 siRNA into the left inflamed joints could achieve the silencing of CCR5 gene and alleviate local inflammation just in the knee joint PMID:25300256
Expression levels of CCR5 mRNA in the spinal cord are up-regulated after nerve injury. PMID:24589480
Blocking CCR5 attenuates, while enhancing CCR5 aggravates myocardial ischemia-reperfusion injury through modulating inflammatory responses in rat heart. PMID:23456481
Early and persistent up-regulation of CCL4/CCR5 signaling during epileptogenesis suggests that CCL4 signalling, rather than CCL2 signalling, could have a role in the epileptogenic process. PMID:22353418
Decrease in CCR5 in circulating cells strongly protected from excitotoxin-induced seizures, blood-brain barrier leakage, CNS injury, and inflammation, and facilitated neurogenic repair. PMID:20940264
CCR5 and CXCR4 are present on the resident testicular macrophages in the interstitial space PMID:11994538
Down-regulation of constitutively expressed surface CCR5 levels by interleukin 1-beta in an insulin-producing model system implies receptor internalization for re-utilization or destruction, secretion or both. PMID:12004163
CCR5 is phosphorylated at specific sites by protein kinase C and GPCR kinase PMID:12403770
Cultured neural progenitor cells from the subventricular zone of adult rat brain express chemokine receptor CCR5. PMID:14732474
CCR5 mediates recruitment of both infiltrating macrophages and resident microglia to sites of central nervous system inflammation. PMID:17484785