Home
Product
Protein
Transmembrane Proteins
Recombinant Rat C-C chemokine receptor type 3 (Ccr3)

Recombinant Rat C-C chemokine receptor type 3 (Ccr3)

Code: CSB-CF004842RA

Rate （N/A）
Review （0）

Size:

20μg100μg

US$5181

Quantity:

Express system: in vitro E.coli expression system

Species: Rattus norvegicus (Rat)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

Ccr3

Uniprot NO.

O54814

Alternative Names

Ccr3; Cmkbr3; C-C chemokine receptor type 3; C-C CKR-3; CC-CKR-3; CCR-3; CCR3; CKR3; CD antigen CD193

Species

Rattus norvegicus (Rat)

Source

in vitro E.coli expression system

Expression Region

1-359

Target Protein Sequence

MASNEEELKTVVETFETTPYEYEWAPPCEKVSIRELGSWLLPPLYSLVFIVGLLGNMMVV LILIKYRKLQIMTNIYLLNLAISDLLFLFTVPFWIHYVLWNEWGFGHCMCKMLSGLYYLA LYSEIFFIILLTIDRYLAIVHAVLALRARTVTFATITSIITWGFAVLAALPEFIFHESQD NFGDLSCSPRYPEGEEDSWKRFHALRMNIFGLALPLLIMVICYSGIIKTLLRCPNKKKHK AIQLIFVVMIVFFIFWTPYNLVLLLSAFHSTFLETSCQQSIHLDLAMQVTEVITHTHCCI NPIIYAFVGERFRKHLRLFFHRNVAIYLRKYISFLPGEKLERTSSVSPSTGEQEISVVF
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Receptor for C-C type chemokine. Binds and responds to a variety of chemokines, including CCL11, CCL26, CCL7, CCL13, RANTES(CCL5) and CCL15. Subsequently transduces a signal by increasing the intracellular calcium ions level. In addition acts as a possible functional receptor for NARS1.

Gene References into Functions

CCR3 plays no role in choroidal neovascularization development. PMID:22183343
Allergen-induced recruitment of eosinophils in the distal septum and turbinates was maximal at 8h post-challenge, and was correlated with 2-4-fold increase in CCR3 and betac mRNA PMID:20696593
demonstrated that CCR3 is absent from the testes PMID:11994538
Down-regulation of constitutively expressed surface CCR3 levels by interleukin 1-beta in an insulin-producing model system implies receptor internalization for re-utilization or destruction, secretion or both. PMID:12004163