Slc27a5; Acsb; Fatp5; Vlacsr; Bile acyl-CoA synthetase; BACS; Bile acid-CoA ligase; BA-CoA ligase; BAL; Cholate--CoA ligase; Fatty acid transport protein 5; FATP-5; Solute carrier family 27 member 5; Very long-chain acyl-CoA synthetase-related protein; VLACS-related; VLACSR
Species
Rattus norvegicus (Rat)
Source
in vitro E.coli expression system
Expression Region
1-690
Target Protein Sequence
MGVWKKLTFLLLSLLLLVGLGQPLWPAATALALRWFLGDPTCFVLLGLAFLGRPWISSWI PHWLSLAAAALTLSLLPPRPPPELRWLHKDVAFAFKLLFYGLNLRRRLNRHPPELFVDAL EQQAQARPDQVALVCTGSEGCSITNRELNAKACQAAWALKAKLKEATIQEDKGATAILVL PSKSISALSVFLGLAKLGCPVAWINPHSRGMPLLHSVQSSGASVLIVDPDLQENLEEVLP KLLAENIRCFYLGHSSPTPGVEALGAALDAAPSDPVPAKLRANIKWKSPAIFIYTSGTTG LPKPAILSHERVIQMSNVLSFCGRTADDVVYNVLPLYHSMGLVLGVLGCLQLGATCVLAP KFSASRYWAECRQYSVTVVLYVGEVLRYLCNVPGQPEDKKHTVRFALGNGLRADVWENFQ QRFGPIQIWELYGSTEGNVGLMNYVGHCGAVGKTSCFIRMLTPLELVQFDIETAEPVRDK QGFCIPVETGKPGLLLTKIRKNQPFLGYRGSQDETKRKLVANVRQVGDLYYNTGDVLALD QEGFFYFRDRLGDTFRWKGENVSTREVEGVLSILDFLEEVNVYGVTVPGCEGKVGMAAVK LAPGKTFDGQKLYQHVRSWLPAYATPHFIRIQDSLEITNTYKLVKSQLAREGFDVGVIAD PLYILDNKAETFRSLMPDVYQAVCEGTWKL
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Acyl-CoA synthetase that catalyzes the activation of bile acids via formation of bile acid CoA thioesters which is necessary for their subsequent conjugation with glycine or taurine. Catalyzes the activation of the primary bile acid, chenodeoxycholic acid. Both primary bile acid (cholic acid) and secondary bile acids (deoxycholic acid and lithocholic acid) are the principal substrates. Also exhibits acyl CoA synthetase activity that activates very long-chain fatty acids (VLCFAs) by catalyzing the formation of fatty acyl-CoA. In vitro, also activates 3-alpha,7-alpha,12-alpha-trihydroxy-5- beta-cholestanate (THCA), the C27 precursor of cholic acid deriving from the de novo synthesis from cholesterol. Exhibits long-chain fatty acids (LCFA) transport activity. Plays an important role in hepatic fatty acid uptake and bile acid reconjugation and recycling but not in de novo synthesis of bile acids.