Recombinant Rat Beta-1 adrenergic receptor (Adrb1)

Code: CSB-CF001391RA
Size:
20μg
20μg100μg
US$5981
Quantity:
Express system: in vitro E.coli expression system
Species: Rattus norvegicus (Rat)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
Adrb1
Uniprot NO.
Alternative Names
Adrb1; Adrb1r; Beta-1 adrenergic receptor; Beta-1 adrenoreceptor; Beta-1 adrenoceptor
Species
Rattus norvegicus (Rat)
Source
in vitro E.coli expression system
Expression Region
1-466
Target Protein Sequence
MGAGALALGASEPCNLSSAAPLPDGAATAARLLVLASPPASLLPPASEGSAPLSQQWTAG MGLLLALIVLLIVVGNVLVIVAIAKTPRLQTLTNLFIMSLASADLVMGLLVVPFGATIVV WGRWEYGSFFCELWTSVDVLCVTASIETLCVIALDRYLAITLPFRYQSLLTRARARALVC TVWAISALVSFLPILMHWWRAESDEARRCYNDPKCCDFVTNRAYAIASSVVSFYVPLCIM AFVYLRVFREAQKQVKKIDSCERRFLTGPPRPPSPAPSPSPGPPRPADSLANGRSSKRRP SRLVALREQKALKTLGIIMGVFTLCWLPFFLANVVKAFHRDLVPDRLFVFFNWLGYANSA FNPIIYCRSPDFRKAFQRLLCCARRAACRRRAAHGDRPRASGCLARAGPPPSPGAPSDDD DDDAGATPPARLLEPWAGCNGGTTTVDSDSSLDEPGRQGFSSESKV
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Beta-adrenergic receptors mediate the catecholamine-induced activation of adenylate cyclase through the action of G proteins. This receptor binds epinephrine and norepinephrine with approximately equal affinity. Mediates Ras activation through G(s)-alpha- and cAMP-mediated signaling. Involved in the regulation of sleep/wake behaviors.
Gene References into Functions
  1. beta-AR stimulation affects post-translational modifications of NF2 via the involvement beta1-AR/PKA/cAMP pathway, and NF2 plays a pro-apoptotic role in beta-AR-stimulated myocyte apoptosis via the phosphorylation (inactivation) of YAP and involvement of mitochondrial death pathway PMID:29709009
  2. Proliferation in cardiac fibroblasts induced by beta1-adrenoceptor autoantibody results in endomyocardial fibrosis. PMID:27577254
  3. Let-7a regulates beta1-AR expression and forms a negative feedback loop with beta1-AR signaling pathway in ischemic heart failure PMID:28060734
  4. beta-AR stimulation induces HDAC5 nuclear accumulation in cardiomyocytes by a mechanism that is protein kinase A-dependent but requires B55alpha-PP2A-mediated dephosphorylation of Ser259/Ser498. PMID:28343149
  5. Using a GalNAc-T2 knock-out rat model, this study shows that GalNAc-T2 co-regulates the metalloproteinase-mediated limited proteolysis of B1AR. PMID:28167537
  6. Suggest a common regulatory pattern for the beta(1)-AR/GRK5 which is independent of cellular type or pathology. PMID:26248277
  7. Data show that beta1-Adrenoceptor stimulation triggers the production of the second messenger cAMP, which activates the Rap guanine nucleotide exchange factor Epac and the protein kinase A (PKA). PMID:26462734
  8. Chronic bilateral renal denervation reduces cardiac hypertrophic remodelling but not beta-adrenergic responsiveness in hypertensive type 1 diabetic rats. PMID:25881071
  9. These findings suggest that PSD95 mediates a vasodilator complex with beta1AR and KV1 channels in cVSMCs PMID:25966954
  10. Results show that beta1-ARs-mediated Nrf2-HO-1-HMGB1 axis regulation plays a critical protective role in H/R-induced neonatal rat cardiomyocytes injury in vitro via PI3K/p38MAPK signaling pathway. PMID:25634756
  11. these data indicate that beta1AR agonist treatment during disuse mitigates negative changes in cancellous bone microarchitecture and inhibits increases in osteocyte apoptosis PMID:25211027
  12. The possible role of medial prefrontal cortex beta-1-adrenoceptors in morphine-induced amnesia PMID:25096537
  13. The aptamer's potential for beta1(II)-AAB neutralization and consequently for cardiomyopathy treatment has been shown for the first time in vivo. PMID:24744110
  14. Despite all three Adrb subtypes being found in both vessels, Adrb1, located in smooth muscle cells and acting through the adenylyl cyclase/cAMP pathway, are primarily responsible for vasodilatation in mesenteric resistance artery PMID:23373597
  15. Data suggest activation of endothelial Adrb1 (beta-1-adrenoceptors) suppresses vasodilation and this is mediated through inhibition of endothelial Kcnn4 (intermediate conductance Ca-activated K channels) depressing endothelial cell hyperpolarization. PMID:23488860
  16. A set of miRNAs is differently expressed in the aorta of high salt treated rats with miR-320 increased and miR-26b and -21 decreased, through beta1 and beta3-adrenoreceptor pathways. PMID:24161401
  17. During the period of sleep deprivation, mRNA levels of adrenergic beta 1 receptors were reduced in frontal cortex. PMID:23916734
  18. The data establish a prominent role for PDZ2 and I3 domains of SAP97 in organizing the ss1-adrenergic receptosome involved in connecting the ss1-AR to trafficking and signaling networks. PMID:23696820
  19. We demonstrate that restoration of cardiac plasma membrane levels of S1PR1 produces beneficial effects that counterbalance the deleterious beta1AR overstimulation in heart failure. PMID:23969695
  20. Up-regulation of beta1AR action was eliminated with 17beta-estradiol addition to the media, directly implicating this hormone as a regulator of beta1AR expression. PMID:23533220
  21. Overexpression of beta(1)-AR has no significant protective effect on rat cardiomyocytes injured by isoprenaline. PMID:21170495
  22. Both alpha1- and beta1-adrenoceptors in the bed nucleus of the stria terminalis are involved in the expression of conditioned contextual fear PMID:22506532
  23. Data show that beta(1)-AR stimulation in response to aorto-caval fistula induces FA signaling downregulation through an ECM-independent mechanism. PMID:22609523
  24. Thus, beta-AR stimulation induces ER stress in cardiac myocytes and in the heart, and induction of ER stress plays a pro-apoptotic role PMID:22270541
  25. the site of action of beta1 receptor activation is most likely on the presynaptic nerve terminals surrounding cardiac vagal neurons PMID:22425752
  26. Spleen T cells were more vulnerable to stress compared to B cells, because of increased beta-, beta- and beta-adrenoceptors after a single immobilization. PMID:22248722
  27. beta(1)-AR and 5-HT(4) receptor signalling are subject to opposite regulatory control by cGMP generated by soluble guanylyl cyclase in failing hearts. PMID:21901315
  28. Stress did not alter Adrb1 expression in heart ventricles. PMID:21777029
  29. Methylation of adrenergic beta1 receptor is a potential epigenetic mechanism controlling antihypertensive response to metoprolol PMID:22165287
  30. results provide further evidence that autoantibody against beta1-AR-extracellular loop is involved in the pathogenesis of heart failure PMID:20096470
  31. Exercise training did not blunt the diabetes-induced decrease of cardiac beta1-adrenoceptor protein expression. PMID:21054861
  32. Our results reinforce the role of the ventromedial prefronal cortex in fear extinction mechanisms, suggesting that ventromedial prefrontal cortex-beta-1-adrenergic receptor activation underlies part of the facilitation of the fear extinction processes. PMID:20667477
  33. An NPR-B-cGMP-PDE3 inhibitory pathway enhances beta(1)-AR-mediated responses and may in the long term be detrimental to the failing heart PMID:19900965
  34. Substance P could down-regulate the expression of beta1-AR in cultured rat cardiomyocytes in vitro. PMID:19111114
  35. Beta(1)-Adrenergic receptor, confined to the plasma membrane, increased phosphatidylserine translocation and apoptosis. PMID:19932173
  36. regulation of cardiac beta(1)AR transcription and the expression of c-myc are tightly integrated PMID:12742828
  37. Noradrenaline depolarizes striatal cholinergic interneurons via beta1-adrenoceptor activation, through a cAMP-dependent but PKA-independent mechanism PMID:12832552
  38. In cardiac myocytes, beta1AR stimulation activates dual signaling pathways mediated by cAMP/PKA and CaMKII, the former undergoing desensitization and the latter exhibiting sensitization. PMID:15375008
  39. Beta1-AR stimulation activates PI3K via PKA, G(betagamma) & betaARK1. This negates cAMP-induced positive inotropism by inhibiting sarcolemmal Ca2+ influx & the subsequent increase in intracellular Ca2+ transients in intact cardiomyocytes. PMID:15539636
  40. beta1-AR stimulation resulted in a greater magnitude and rate of onset of inotropic and MVO2 responses than did beta2-AR but, a similar decrease in intracellular energy charge was seen in the two groups during beta1- than during beta2-AR stimulation. PMID:15840637
  41. correlate phosphorylation of S1928 with beta1-adrenergic functional up-regulation of cardiac calcium channels in the presence of 1,2-bis(2-aminophenoxy)ethane-N',N'-tetraacetic acid in intact ventricular myocytes PMID:17053072
  42. Almost all of the neuronal nuclei positive cells express beta1-adrenergic receptor while few glial fibrillary acidic protein positive cells express them. Interestingly, beta1-ARs are predominantly distributed in the cell membrane and cytoplasm. PMID:17337326
  43. Beta(1)-ARs were immunolocalized to sites overlapping apical and basal poles of the inner and outer hair cells, in Hensen's and Deiters' cells would couple to Galphas, known to be present specifically in the supporting cells. PMID:17671986
  44. These findings suggest that in the myocardium the regulated expression of EMMPRIN is a determinant of MMP activity and may thus play a role in myocardial remodeling. PMID:17869266
  45. The results suggested that beta(1)-AR might be critical for the retrieval of auditory fear memory. PMID:17961922
  46. Partial left ventricular unloading regressed myocardial hypertrophy, reversed contractile dysfunction and normalized the mRNA beta(1)-adrenergic receptors expression of failing rat hearts. PMID:18006556
  47. Endocytosis machinery is required for beta1-adrenergic receptor-induced hypertrophy in neonatal rat cardiac myocytes. PMID:18194989
  48. Beta1-adrenoceptor expression in rat anterior pituitary gonadotrophs. PMID:18202120
  49. beta(1)-AR significantly contributes to basal adenylate cyclase activity in the pituitary. PMID:18202135
  50. Labetalol-induced inhibition of PAG cell firing is due to its potentiation of GABAergic transmission. Labetalol-induced analgesia is due to its antagonistic effects on presynaptic beta1-adrenoceptors. PMID:18262504

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein. Early endosome.
Protein Families
G-protein coupled receptor 1 family, Adrenergic receptor subfamily, ADRB1 sub-subfamily
Tissue Specificity
Expressed in cortical neurons and coronary artery smooth muscle cells (at protein level).
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products