MDTRSSLCPKTQAVVAVFWGPGCHLSTCIEMFNITTQALGSAHNGTFSEVNCPDTEWWSWLNAIQAPFLWVLFLLAALENIFVLSVFCLHKTNCTVAEIYLGNLAAADLILACGLPFWAITIANNFDWLFGEVLCRVVNTMIYMNLYSSICFLMLVSIDRYLALVKTMSMGRMRGVRWAKLYSLVIWSCTLLLSSPMLVFRTMKDYREEGHNVTACVIVYPSRSWEVFTNMLLNLVGFLLPLSIITFCTVRIMQVLRNNEMKKFKEVQTEKKATVLVLAVLGLFVLCWFPFQISTFLDTLLRLGVLSGCWNERAVDIVTQISSYVAYSNSCLNPLVYVIVGKRFRKKSREVYQAICRKGGCMGESVQMENSMGTLRTSISVDRQIHKLQDWAGNKQ
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Receptor for bradykinin. It is associated with G proteins that activate a phosphatidylinositol-calcium second messenger system.
Gene References into Functions
Findings suggest that bradykinin 1 receptor and bradykinin 2 receptor have detrimental and beneficial effects, respectively in diabetic cerebral ischaemia.PMID:26565562
Up-regulation of the kinin B2 receptor pathway modulates the TGF-beta/Smad signaling cascade to reduce renal fibrosis induced by albumin.PMID:26256678
These results indicate that B2R couples with P2Y2R and that these G-protein-coupled receptors act together to fine-tune cellular responsiveness.PMID:25713410
B2R signaling may regulate monocyte/macrophage infiltration and c-Jun signals in the irradiated heart. Although eNOS is a main target for kinins, the B2R may not regulate eNOS phosphorylation in response to radiation.PMID:25955317
bradykinin receptor B1 may participate in apoptotic cell death signalling, and bradykinin receptor B2 may be involved in necrotic cell deathPMID:24724708
Data indicate that ANO1 channels form signaling complexes with IP3 receptor (IP3R1) and GPCRs bradykinin receptor 2 (B2R) and protease-activated receptor 2 (PAR-2).PMID:23982204
The neuroprotective feature of bradykinin stimulates the kinin-B2 receptor (B1BKR), providing a novel understanding of the physiological roles of these receptors.PMID:23735753
the role of bradykinin B2 receptor in vascular endothelium and it's regulation by bradykinin B1 receptorPMID:23306173
Data suggest that expression of Bdkrb2 is up-regulated in adrenal medulla as the result of stress (here, immobilization stress); data from rats with pharmacological adrenalectomy suggest this up-regulation requires adrenomedullary glucocorticoids.PMID:24025224
Heightened bradykinin B2 receptor expression in the sensory nerves contributes to the exaggerated muscle mechanoreflex in rats with femoral artery occlusion.PMID:23417862
Data show the important roles of B1 and B2 bradykinin receptors in overactive urinary bladder syndrome (OAB) following spinal cord injury in rats and suggest that blockade of these receptors could be a therapeutic target for controlling OABPMID:22862305
Kinin-B2 receptor activity determines the differentiation fate of neural stem cells.PMID:23132855
Observations demonstrate a novel role of plasma kallikrein and bradykinin activation in the synovial recruitment of endothelial stem cells in arthritis, acting via kallikrein activation and B2R-dependent mechanisms.PMID:22739815
Our study suggests that hyperglycemia induces apoptosis via the stimulation of B1R and B2R expression through CB1R activation in rat podocytes in vitroPMID:22877648
Aging cardiac endothelial cells gradually lose their capacity to express BK-2Rs.PMID:21986469
In the medulla, chronic exercise could hyperstimulate the kallikrein-kinin system enhancing its efficiency via the increase of bradykinin B2 receptor density, involving this receptor in central cardiovascular control during exercise or stress.PMID:20637711
expression of KLKI and B2R changed in an age-dependent pattern in the corpus cavernosum and have a tendency to decline during ageingPMID:20345876
Tanshinone IIA is cardioprotective in the context of diabetic cardiomyopathy through kinin B2 receptor-Akt-GSK-3beta dependent pathway.PMID:21232147
Data suggest that spinal dynorphin may maintain pancreatitis pain through direct or indirect activation of BK B2 receptors in the spinal cord.PMID:20531238
The structure of the rat kinin B2 receptor gene (KB2r) and encoding messenger RNA (mRNA) processing, was examined.PMID:20198577
Although B2BKR expression was not altered in the middle cerebral arteries of spontaneously hypertensive rats after hypertensive encephalopathy or cerebral hemorrhage, bradykinin-mediated relaxation was abolished.PMID:19954757
in normal rat knee joints, PAR4 activation increases joint primary afferent activity in response to mechanical stimuli. This PAR4-induced sensitization is TRPV1-independent but involves B2 receptor activation, suggesting a role for kinins in this processPMID:19889854
Data show that bradykinin-induced plasma extravasation is mediated by bradykinin B2 receptors and is inhibited by nociceptin.PMID:19544046
MEDIATES the formation of vasogenic brain edema in ratsPMID:11686492
Upregulation of kinin B2 receptor mRNA in the hypothalamus of spontaneously hypertensive rats from early age may participate in the pathogenesis of hypertension.PMID:12025958
Activation of bradykinin 2 receptor negatively modulates the phosphorylation of Erk1 and Erk2 induced by insulin-like growth factor-1, platelet-derived growth factor-BB, and high glucose in the kidney glomerulus.PMID:12025970
the cell-specific regulation of the BKB2 receptor and the importance of a silencer element present in the regulatory region of the gene.PMID:12435802
results demonstrated a stage-specific expression of the bradykinin B(2) receptor in different cells of the seminiferous tubules of the rat testisPMID:12444060
Up-regulation of bradykinin B2-receptor in early stages of cardiac wound healing induced by ischemia and in chronic stages of cardiac remodeling indicates that kinins play a major role in the complex processes of cardiac tissue injury and repairPMID:12489796
findings suggest that bradykinin B2 receptor is involved in mediating the stimulatory effect of bradykinin on pro-spermatogonial cell proliferationPMID:12558524
stage-dependent specific expression of tissue kallikrein and bradykinin B2 receptors in developing germ cells and peritubular cells suggests a potential role in the local regulation of spermatogenesisPMID:12558526
Down-regulation of bradykinin B2-receptor mRNA in the heart in pressure-overload cardiac hypertrophy in the rat.PMID:12623134
increased bradykinin B(2) receptor expression in the hypothalamus and adrenal glands may play a role in the abnormalities of the hypothalamo-pituitary-adrenal axis during the development of hypertensionPMID:12639805
Effects of angiotensin II on cell differentiation and cyclic GMP production were mediated via the AT2 receptor and further enhanced by bradykinin B2 receptor blockadePMID:12694402
Kindling-induced epilepsy results in a significant decline of B(2) receptor binding sites in the rat brain. An altered balance between B(1) and B(2) receptor populations may play a pivotal role in the onset and/or maintenance of epilepsy.PMID:12746865
there are two functionally divergent p53-responsive elements in the rat bradykinin B2 receptor promoterPMID:12791684
ongoing pressure overload leads to a loss of BK-2Rs with a dramatic increase in left ventricular fibrosis followed by diastolic dysfunction and heart failure.PMID:12923406
Mediator role of bradykinin in ischemic brain damage including edema formation, obviously by ligand binding to bradykinin B2 receptor. Receptor antagonist may be treatment in stroke patients.PMID:14753436
Angiotensin II regulates expression of B2KR in vascular smooth muscle cellsPMID:14766673
B1R & B2R signaling show physiologic antagonism. B2R antagonism decreased leukocyte & synovial CD44 & CD54 & endothelial CD11b expression, implicating B2R in the acute phase of inflammation by facilitating leukocyte activation, homing, & transmigration.PMID:15001555
These studies demonstrate that urothelial expression of bradykinin receptors is plastic and is altered by pathology.PMID:15576455
phospholipase C (PLC)gamma1 can interact with the immunoreceptor tyrosine-based inhibition motif (ITIM) sequence located in the C-terminal part of the bradykinin B2 receptor; interaction was only observed in quiescent and not in proliferating cellsPMID:15607753
Age-related decreases in bradykinin B2 receptor may leave heart vulnerable to ischemic damage, and increases in bradykinin B1 receptor may represent compensatory reaction in aging hearts.PMID:15708952
In conclusion, the findings from this study indicate that exercise training alters the localization of FAT/CD36 and increases its association with CPT I, which may help augment fat oxidation.PMID:16507603
after hepatic ischemia, angiotensin-converting enzyme (ACE) inhibition reduced reperfusion injury in a bradykinin-2-receptor-dependent mannerPMID:16513137
We report the distance between the AT2R and B2R in PC12W cell membranes to be 50+/-5 A, providing evidence and quantification of receptor heterodimerization as the mechanism for enhancing NO productionPMID:16754789
Implication of both kinin B1 and B2 receptors in thermal hyperalgesia but not in tactile and cold allodynia associated with peripheral nerve injury.PMID:18182225
Results show that plasma membrane and highly purified nuclei from isolated rat hepatocytes contain specific bradykinin B2 receptors that bind bradykinin.PMID:18264983
kinin-B2 receptors and BK secretion indicate an autocrine loop during neurosphere differentiation to neurons, astrocytes, and oligodendrocytes, reflecting events occurring during early brain developmentPMID:18302192