MASEVLLELQPSNRSLQAPANITSCESALEDWDLLYRVLPGFVITICFFGLLGNLLVLSF FLLPWRQWWWQQRQRQQRLTIAEIYLANLAASDLVFVLGLPFWAENIGNRFNWPFGTDLC RVVSGVIKANLFVSIFLVVAISQDRYRLLVYPMTSWGYRRRRQAQATCLLIWVAGGLLSI PTFLLRSVKVVPDLNVSACILLFPHEAWHFARMVELNVLGFLLPVTAIIFFNYHILASLR GQKEASRTRCGGPKGSKTTGLILTLVASFLVCWCPYHFFAFLDFLVQVRVIQDCSWKEIT DLGLQLANFFAFVNSCLNPLIYVFAGRLLKTRVLGTL
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
This is a receptor for bradykinin. Could be a factor in chronic pain and inflammation.
Gene References into Functions
The experimental periodontitis in rats can induce systemic inflammation and up-regulate B1 kinin receptors in the rat paw, modifying the inflammatory response at a site distant from oral infection.PMID:29225113
Hearts of rats overexpressing the B1R exclusively in the endothelium have expanded LV cavities with reduced capacity to generate pressure and shortening, suggesting myocardial depression.PMID:28937259
upregulated B1R may contribute to early hemorrhagic transformation after cerebral ischemia/reperfusion in type 1 diabetic ratsPMID:28726167
data imply in a possible participation of B1R in the short term memory impairment observed in traumatic brain injury, neuroinflammation and neurodegenerationPMID:26669247
Kinin B1R contributes to acute gouty attacks, including the ones facilitated by ACEi.PMID:25344431
Data suggest that kinin B1R is upregulated by the oxidative stress in the brain of insulin-resistant rats and its activation causes stereotypic nocifensive behavior through the release of substance P, glutamate and NO.PMID:25959537
Preclinical pharmacology, metabolic stability, pharmacokinetics and toxicology of the peptidic kinin B1 receptor antagonist R-954.PMID:24361511
bradykinin B2 receptor expression is upregulated in vascular endothelium by overexpression of B1 bradykinin receptorPMID:23306173
There was no significant difference in B1 receptor expression in both experimental groups, and arterial injection of R-715, a B1 receptors blocker, had no significant effects on RSNA and MAP responses evoked by muscle stretch.PMID:23417862
Data from a model applying fresh smoke (or the vapor phase/particulate matter) to lung slices in 3-day culture confirm up-regulation of stress-response genes (bradykinin B1 receptor, IL-1beta, and CYP1A1) along with damage to alveolar structure.PMID:22266391
The bradykinin B1 receptor antagonist R-954 inhibited edema in rat paw suggested that the B1 receptors were involved in the tumor growth.PMID:21835216
Kinin B1 receptor enhances the oxidative stress in a rat model of insulin resistance.PMID:20830306
Results demonstrate the involvement of bradykinin B(1) receptor in cigarette smoke-induced airway inflammation through a mechanism which is mediated by the pro-inflammatory cytokine IL-1beta.PMID:20637817
The upregulation of kinin B1R in spinal dorsal horn microglia by pro-inflammatory cytokines is proposed as a crucial mechanism in early pain neuropathy in STZ-diabetic rats.PMID:20587056
Upregulation of kinin B1 receptor mRNA in the hypothalamus of spontaneously hypertensive rats in the established phase of hypertension may reflect an epiphenomenon in essential hypertension.PMID:12025958
Induction of renal bradykinin B1 receptor expression in streptozotocin diabetic rats is strongly supported by the increase in B1 receptor protein and mRNA as well as by the functional effect of B1 antagonist on Erk-1 and Erk-2 phosphorylation.PMID:12025968
Results support an important role for kinin B(1) receptors in modulating inflammatory responses and for the first time demonstrates that B(1) receptors mediate a hypertensive response to des-Arg(9)-bradykinin.PMID:12411434
Up-regulation of bradykinin B1-receptor in early stages of cardiac wound healing induced by ischemia and in chronic stages of cardiac remodeling indicates that kinins play a major role in the complex processes of cardiac tissue injury and repairPMID:12489796
Kinin B1 receptor is up-regulated in the streptozotocin-diabetic rat lung, and its activation increases leukocyte infiltration into the pleural cavity; B1 receptor overexpression seems to depend on neutrophil influx and association with hyperglycemia.PMID:12522068
Kindling-induced epilepsy results in a striking increase of B(1) receptor labeling in the rat brain. An altered balance between B(1) and B(2) receptor populations may play a pivotal role in the onset and/or maintenance of epilepsy.PMID:12746865
B1 bradykinin receptors that are expressed both in the periphery and in the spinal cord have a functional role in mechanical hyperalgesia during inflammation.PMID:12927641
upregulated during reperfusion; influences number of adherent leukocytes in post-capillary venules; carboxypeptidase M activity is upregulated when receptor ligands are used; located on acinar cell membranes; antagonism of Bdkrb1 decreases survival ratePMID:14515994
B1R and B2R signaling show physiologic antagonism. B1R signaling suggests involvement in down-regulation of leukocyte activation, transmigration, and homing.PMID:15001555
Bradykinin B1 receptor expression is upregulated by tissue damage in the portal vein.PMID:15087417
renal B1R might be over-expressed in a high blood pressure condition, and that this upregulated B1 R may play an important role in renal protection by inhibiting renal fibrosis via an increase of NO production and a suppression of TGFbeta1 expressionPMID:15253105
Specific B1 receptor activation causes translocation of the epsilon isoform of protein kinase C to the membrane of a small fraction of sensory neurones.PMID:15319421
The role of Bradykinin B1 Receptor in the heart may be attenuation of cardiac remodeling via inhibition of the expression of MAP kinases and TGF-beta1 through an increase in eNOS activity in a hypertensive condition.PMID:16497153
in the 2K-1C rat, induction of cardiac B1 receptor might be tightly linked to AT1 receptor activationPMID:16822558
This significant increase in densities of kinin B(1) and B(2) receptors in animals submitted to Abeta infusion was observed mainly in brain regions related to cognitive behavior.PMID:17570564
results provide evidence that angiotensin II induces B1 receptor expression in aorta by superoxide anion generation, via reduced nicotinamide-adenine dinucleotide phosphate oxidase, concomitant to nuclear factor kappaB activationPMID:17664391
oxidative stress contributes to the induction and up-regulation of B(1)R in the model of insulin resistance induced by glucose feeding. The over expressed B(1)R contributes centrally to arterial hypertension and in the periphery to sensory abnormalities.PMID:17988733
Treatment with an antioxidant or an ACE inhibitor has beneficial effects on sensory polyneuropathy, hypertension and insulin resistance in glucose-fed rats which were associated with a reduced kinin B(1) receptor expression.PMID:18555989
gene deletion of BKR prevents cardiac inflammation and fibrosis in experimental diabetic angiopathy.PMID:19276445
detection of kinin B1 receptor in primary microglial cell culture and on microglial cells, astrocytes and sensory C fibers in the thoracic spinal cord of STZ-diabetic ratsPMID:19323833
Tyr-kinase activity sensitive to AG 1478 is recruited by tissue damage and exogenous EGF to upregulate bradykinin B(1) receptors in freshly isolated aortas.PMID:19374866