Recombinant Rat Alpha-2C adrenergic receptor (Adra2c)

Code: CSB-CF001390RA
Size:
20μg
20μg100μg
US$5922
Quantity:
Express system: in vitro E.coli expression system
Species: Rattus norvegicus (Rat)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
Adra2c
Uniprot NO.
Species
Rattus norvegicus (Rat)
Source
in vitro E.coli expression system
Expression Region
1-458
Target Protein Sequence
MASPALAAALAAAAAEGPNGSDAGEWGSGGGANASGTDWGPPPGQYSAGAVAGLAAVVGF LIVFTVVGNVLVVIAVLTSRALRAPQNLFLVSLASADILVATLVMPFSLANELMAYWYFG QVWCGVYLALDVLFCTSSIVHLCAISLDRYWSVTQAVEYNLKRTPRRVKATIVAVWLISA VISFPPLVSFYRRPDGAAYPQCGLNDETWYILSSCIGSFFAPCLIMGLVYARIYRVAKLR TRTLSEKRGPAGPDGASPTTENGLGKAAGENGHCAPPRTEVEPDESSAAERRRRRGALRR GGRRREGAEGDTGSADGPGPGLAAEQGARTASRSPGPGGRLSRASSRSVEFFLSRRRRAR SSVCRRKVAQAREKRFTFVLAVVMGVFVLCWFPFFFSYSLYGICREACQLPEPLFKFFFW IGYCNSSLNPVIYTVFNQDFRRSFKHILFRRRRRGFRQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Alpha-2 adrenergic receptors mediate the catecholamine-induced inhibition of adenylate cyclase through the action of G proteins.
Gene References into Functions
  1. new data suggest that alpha2-adrenoceptors play no major role on any indices of female sexual behavior. PMID:25218984
  2. the deleterious effect of prenatal malnutrition on neocortical plasticity in the adult progeny is in part consequence of increased neocortical alpha(2C)-adrenoceptor expression PMID:22892388
  3. In 6-OHDA-lesioned rats, there was no change in alpha2C adrenoceptor expression in the rostral or caudal striatum in which the highest density of alpha2C mRNA is present. PMID:21562737
  4. In aging, the alpha-2C receptor mediated feedback inhibition of epinephrine release from the adrenal medulla is preserved in control rats but compromised in hypertensive rats, resulting in increased epinephrine release. PMID:20691504
  5. During the development of hypertension, adrenal alpha(2) -adrenoceptor inhibitory function is conserved, accompanied by reduced noradrenaline release and unchanged adrenaline release in spontaneously hypertensive rats. PMID:21518261
  6. Stimulation of adrenergic alpha 2 receptors in the central nucleus of the amygdala attenuates stress-induced reinstatement of nicotine seeking behavior. PMID:20854830
  7. Results suggest that changes of beta(2)- and alpha(2C)-adrenergic receptors participate in IL-6-mediated processes in the spleen, especially during chronic stress situations. PMID:20607388
  8. In a chronic spinal cord injury rat model, alpha(2)-ARs gene expression is downregulated in the injured segment, but returns to the normal level above and below the injured segment. PMID:19000416
  9. intraspinal modulation of the noradrenergic and adrenergic control of the autonomic outflow to the penis by pre- and postsynaptic alpha(2) adrenoceptors. PMID:12379250
  10. Alpha 2C-adrenergic receptors are present on axon terminals of spinal interneurons, the majority of them forming axo-dendritic synapses, although a small number of axo-axonic synapses are also found. PMID:12401319
  11. Data indicate that most dorsal horn axons possessing alpha 2C-adrenergic receptors are excitatory, adding further support to the suggestion that they originate principally from spinal interneurons. PMID:12591145
  12. Alpha 2C-AR terminals are presynaptic to dendrites and somata of lateral spinal nucleus (LSN) neurons and predominantly form asymmetric synapses. PMID:15207357
  13. alpha(2A)- and alpha(2C)-adrenoceptors play predominant roles in the regulation of cervical resistance on days 18-21. PMID:19450576

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family, Adrenergic receptor subfamily, ADRA2C sub-subfamily
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products