MASPALAAALAAAAAEGPNGSDAGEWGSGGGANASGTDWGPPPGQYSAGAVAGLAAVVGF LIVFTVVGNVLVVIAVLTSRALRAPQNLFLVSLASADILVATLVMPFSLANELMAYWYFG QVWCGVYLALDVLFCTSSIVHLCAISLDRYWSVTQAVEYNLKRTPRRVKATIVAVWLISA VISFPPLVSFYRRPDGAAYPQCGLNDETWYILSSCIGSFFAPCLIMGLVYARIYRVAKLR TRTLSEKRGPAGPDGASPTTENGLGKAAGENGHCAPPRTEVEPDESSAAERRRRRGALRR GGRRREGAEGDTGSADGPGPGLAAEQGARTASRSPGPGGRLSRASSRSVEFFLSRRRRAR SSVCRRKVAQAREKRFTFVLAVVMGVFVLCWFPFFFSYSLYGICREACQLPEPLFKFFFW IGYCNSSLNPVIYTVFNQDFRRSFKHILFRRRRRGFRQ
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Alpha-2 adrenergic receptors mediate the catecholamine-induced inhibition of adenylate cyclase through the action of G proteins.
Gene References into Functions
new data suggest that alpha2-adrenoceptors play no major role on any indices of female sexual behavior.PMID:25218984
the deleterious effect of prenatal malnutrition on neocortical plasticity in the adult progeny is in part consequence of increased neocortical alpha(2C)-adrenoceptor expressionPMID:22892388
In 6-OHDA-lesioned rats, there was no change in alpha2C adrenoceptor expression in the rostral or caudal striatum in which the highest density of alpha2C mRNA is present.PMID:21562737
In aging, the alpha-2C receptor mediated feedback inhibition of epinephrine release from the adrenal medulla is preserved in control rats but compromised in hypertensive rats, resulting in increased epinephrine release.PMID:20691504
During the development of hypertension, adrenal alpha(2) -adrenoceptor inhibitory function is conserved, accompanied by reduced noradrenaline release and unchanged adrenaline release in spontaneously hypertensive rats.PMID:21518261
Stimulation of adrenergic alpha 2 receptors in the central nucleus of the amygdala attenuates stress-induced reinstatement of nicotine seeking behavior.PMID:20854830
Results suggest that changes of beta(2)- and alpha(2C)-adrenergic receptors participate in IL-6-mediated processes in the spleen, especially during chronic stress situations.PMID:20607388
In a chronic spinal cord injury rat model, alpha(2)-ARs gene expression is downregulated in the injured segment, but returns to the normal level above and below the injured segment.PMID:19000416
intraspinal modulation of the noradrenergic and adrenergic control of the autonomic outflow to the penis by pre- and postsynaptic alpha(2) adrenoceptors.PMID:12379250
Alpha 2C-adrenergic receptors are present on axon terminals of spinal interneurons, the majority of them forming axo-dendritic synapses, although a small number of axo-axonic synapses are also found.PMID:12401319
Data indicate that most dorsal horn axons possessing alpha 2C-adrenergic receptors are excitatory, adding further support to the suggestion that they originate principally from spinal interneurons.PMID:12591145
Alpha 2C-AR terminals are presynaptic to dendrites and somata of lateral spinal nucleus (LSN) neurons and predominantly form asymmetric synapses.PMID:15207357
alpha(2A)- and alpha(2C)-adrenoceptors play predominant roles in the regulation of cervical resistance on days 18-21.PMID:19450576