Recombinant Rat Alpha-2A adrenergic receptor (Adra2a)

Code: CSB-CF001388RA
Size:
20μg
20μg100μg
US$7620
Quantity:
Express system: in vitro E.coli expression system
Species: Rattus norvegicus (Rat)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
Adra2a
Uniprot NO.
Alternative Names
Adra2a; Alpha-2A adrenergic receptor; Alpha-2A adrenoreceptor; Alpha-2A adrenoceptor; Alpha-2AAR; Alpha-2D adrenergic receptor; CA2-47
Species
Rattus norvegicus (Rat)
Source
in vitro E.coli expression system
Expression Region
1-450
Target Protein Sequence
MGSLQPDAGNSSWNGTEAPGGGTRATPYSLQVTLTLVCLAGLLMLFTVFGNVLVIIAVFTSRALKAPQNLFLVSLASADILVATLVIPFSLANEVMGYWYFGKVWCEIYLALDVLFCTSSIVHLCAISLDRYWSITQAIEYNLKRTPRRIKAIIVTVWVISAVISFPPLISIEKKGAGGGQQPAEPSCKINDQKWYVISSSIGSFFAPCLIMILVYVRIYQIAKRRTRVPPSRRGPDACSAPPGGADRRPNGLGPERGAGTAGAEAEPLPTQLNGAPGEPAPTRPRDGDALDLEESSSSEHAERPQGPGKPERGPRAKGKTKASQVKPGDSLPRRGPGAAGPGASGSGQGEERAGGAKASRWRGRQNREKRFTFVLAVVIGVFVVCWFPFFFTYTLIAVGCPVPYQLFNFFFWFGYCNSSLNPVIYTIFNHDFRRAFKKILCRGDRKRIV
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Alpha-2 adrenergic receptors mediate the catecholamine-induced inhibition of adenylate cyclase through the action of G proteins.
Gene References into Functions
  1. It is concluded that activation of alpha2A-adrenergic signal in chondrocytes promotes temporomandibular joint degenerative remodelling by chondrocyte-mediated pro-catabolic activities. PMID:27452863
  2. the excitatory input and post-synaptic dynamics of pontine reticular nucleus reticulospinal neurons are indeed intricately modulated by the activation of alpha1- and alpha2-adrenoceptors. PMID:26676573
  3. Study showed that alpha2A adrenergic receptors are highly expressed in the cell bodies and axons of mesoprefrontal dopaminergic neurons provides a morphological basis to the vast functional evidence that somatodendritic and nerve-terminal alpha2A adrenergic receptors control dopaminergic activity and dopamine release in the prefrontal cortex. PMID:27365174
  4. Data show that the central alpha2 receptor agonists clonidine and dexmedetomidine are effective to attenuate local and systemic injury in experimental severe necrotizing pancreatitis (SNP) and should be evaluated in the clinical setting. PMID:26418907
  5. Report specific roles of alpha2A - and alpha2B -, but not alpha2C -, adrenoceptor subtypes in the inhibition of the vasopressor sympathetic out-flow in diabetic pithed rats. PMID:25407049
  6. Results provide support for a link between early-life stress, susceptibility for high alcohol consumption, and low Adra2a expression in the hypothalamus. PMID:26121187
  7. Dopamine-elicited outward current in subcoeruleus nucleus neurons are mediated by adrenergic alpha2 receptors. PMID:24304869
  8. Data indicate that co-expression of alpha1A- and alpha2A-adrenoceptor in the same neuron was observed in normal DRG and increased post chronic constriction injury of sciatic nerve (CCI). PMID:24939293
  9. Our results demonstrate a new paradigm of GPCR-mediated presynaptic inhibition in the CNS and add a new regulatory mechanism at a critical presynaptic site in the visual pathway that controls the transmission of scotopic information. PMID:25009274
  10. Stimulation of nucleus tractus solitarii Adra2a triggers unknown inhibitory mechanisms inhibiting cardiopulmonary chemoreflex pathway transmission when adenosine is released into the NTS during severe hypotension. PMID:24216055
  11. Throughout the period of sleep restriction, mRNA levels of adrenergic alpha2 receptors was reduced in the frontal cortex. PMID:23916734
  12. The regulation of alpha 2 adrenergic receptor by merazin hydrate reveals a role for an antidepressive effect. PMID:23063894
  13. Changes of alpha2A receptor mRNA expression observed in the locus coeruleus may be of importance to basal ganglia transmission and motor function. PMID:21562737
  14. In aging the alpha-2A receptor mediated feedback inhibition of epinephrine release from the adrenal medulla is preserved in control rats but compromised in hypertensive rats, resulting in increased epinephrine release. PMID:20691504
  15. alpha2-ar activity, which controls the firing of LC noradrenergic neurons, was unaltered in the rat CCI model of peripheral neuropathic pain. PMID:22038538
  16. Data indicate that the alpha2 adrenergic receptors regulate CCL2/MCP-1 expression in astrocytes, working as inhibitory mediators. PMID:21963947
  17. Negative regulation of the waking state in rat pups is an intrinsic function of brainstem alpha2A-adrenergic receptors, activated by exogenous agonists as well as by endogenous noradrenaline. PMID:20884323
  18. We suggest that reduced stress resilience after TSS may be related to oxidative stress, depletion of GRK3 and impaired regulation of alpha(2A)-AR and CRF(1)-R in LC. PMID:21333691
  19. upregulation of a2A-AR with the concomitant reduction of MKP-1 in the liver due to chronic alcohol exposure leads to increased production of TNF-a, and subsequent TNF-a-mediated hepatic damage. PMID:21575605
  20. Study show that inhibitory alpha-2-adrenoceptors are significantly more strongly expressed in type 2 diabetic rats than in control Wistar rats. PMID:20371702
  21. Splenic tissue concentrations of alpha(2A)-AR, PDE4D, CD14, and TLR4 were significantly increased in septic aged rats as compared to aged sham rats and septic young rats. PMID:20302880
  22. TRPM8 is inhibited via the alpha 2A adrenoreceptor signaling pathway PMID:20110357
  23. in congenic strains from the diabetic Goto-Kakizaki rat, study identified a 1.4-megabase genomic locus linked to impaired insulin granule docking at the plasma membrane & reduced beta cell exocytosis; in this locus Adra2a was significantly overexpressed PMID:19965390
  24. Cafeteria-diet feeding for 15 days altered the alpha(2A)- and beta(3)-AR protein levels with an increase of alpha(2A)-AR in males and a beta(3)-AR decrease in females. PMID:11943840
  25. reduction of alpha2A-AR mRNA expression of in brain stem moderately increased plasma corticosterone and had anxiolytic-like effect in the elevated plus-maze PMID:11965357
  26. We show here that a 48-h increase in plasma FFA alters the binding characteristics of beta-cell alpha2 adrenoceptors in rats PMID:12056593
  27. Alpha 2a adrenergic receptors are localized to plasmalemmal and cytoplasmic sites in neuronal and glial profiles within the central nucleus of the amygdala. PMID:12373741
  28. intraspinal modulation of the noradrenergic and adrenergic control of the autonomic outflow to the penis by pre- and postsynaptic alpha(2) adrenoceptors. PMID:12379250
  29. role in the induction of cold anesthesia in neonatal rats PMID:12705135
  30. The impairment of the alpha-2R mediated presynaptic negative feedback mechanism by a reduced expression of the alpha-2R subtype A may increase cardiac net secretion of norepinephrine in SHR and could therefore contribute to their hypertensive phenotype. PMID:12817185
  31. Most glutamic acid decarboxylase immunopositive neurons through the magnocellular preoptic nucleus and substantia innominata were labelled for the alpha2AAR PMID:12911769
  32. Transiently overexpressed alpha2ARs in the developing brain participate in the control of DNA synthesis in a biphasic manner, with promotional actions at low, endogenous levels of stimulation, but inhibitory effects when stimulation is high. PMID:15351511
  33. We detected the alpha2A-AR protein in cholinergic as well as in non-cholinergic basal forebrain neurons. Almost half of all cholinergic neurons contained this adrenergic receptor. PMID:15475682
  34. Suppression of catechol-O-methyltransferase activities, decrease in degradation of norepinephrine (NE), and increase in NE release by blunting of alpha(2)-AR function may be involved in salt-sensitive hypertension in Dahl salt-sensitive rats. PMID:17510509
  35. In PC12 cells, the alpha2-AR subtypes cause phosphorylation and activation of CREB through a pathway involving stimulation of PLC, AA release, generation of epoxygenase derivative and increase of PKA activity. PMID:17680988
  36. Antisense oligonucleotide to alpha2A-adrenoceptors increased the levels of mRNA (reverse polymerase chain reaction) and protein for a key executioner protease of apoptosis caspase-3 (immunoblotting assay) in the cerebral cortex of newborn rats. PMID:18225740
  37. Peripheral nerve injury can result in the suppression of noradrenergic spinal alpha(2)-adrenoceptor-mediated inhibition of spinal dorsal horn neuronal activity evoked by low-intensity mechanical stimuli. PMID:18226963
  38. NADPH oxidase/superoxide and RhoA/Rho kinase are involved in the interaction between alpha(2)-adrenoceptors and angiotensin II on renal vascular resistance. PMID:18250367
  39. The present study evaluated the role of oxidative stress on alpha(2)-adrenoceptor-mediated events (Cl(-)/HCO (3) (-) exchanger activity and cAMP accumulation) in immortalized renal proximal tubular epithelial (PTE) cells. PMID:18491035
  40. Dopamine displaces the binding of the selective alpha(2)-adrenergic ligand, [(3)H]RX821002, in the brain of the three species with an affinity approximately 10-28-fold lower than that of norepinephrine. PMID:18924139
  41. These data indicate that alpha-2A agonists are effective at counteracting the hyperdopaminergic state induced by PCP and may play a role in their neurobehavioral effects in this putative animal model for schizophrenia. PMID:18977208
  42. Central alpha(2A)adrenergic receptor, but not I(1)-imidazoline or alpha(2B)adrenergic receptor, signaling is implicated in the synergistic enhancement of ethanol-evoked behavioral impairment by clonidine. PMID:19120051
  43. Data show that short-term knockdown of alpha2A-adrenergic receptor gene expression in the rat brain by siRNA or antisense oligodeoxynucleotide during the first days of life induced acute and long-lasting neurochemical and behavioral alterations. PMID:19120135
  44. There is an interaction between adenosine A1 receptors and alpha2-adrenoceptors within specific subnuclei of the nucleus tractus solitarius. PMID:19139607
  45. extensive colocalization between alpha(2A)-adrenergic and delta-opioid receptors (DOP) on substance P (SP)-immunoreactive (-ir) varicosities in the superficial dorsal horn of the spinal cord and in peripheral nerve terminals in the skin were observed PMID:19180644
  46. dorsomedial pontine neurons with axonal projections to the medial medulla contain orexin-1r and adrenergic alpha2Ar mRNAs: these receptors may function as presynaptic receptors on the medullary and other axon terminals of these dorsomedial pontine neurons PMID:19427365
  47. Findings provide important feasibility information for further developing the alpha(2A)-AR antagonist as a new therapy for sepsis. PMID:19430535
  48. alpha(2A)- and alpha(2C)-adrenoceptors play predominant roles in the regulation of cervical resistance on days 18-21. PMID:19450576
  49. role for the A(2A)R-EET pathway in the adaptive natriuretic response to modulate blood pressure during salt loading. PMID:19822802

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family, Adrenergic receptor subfamily, ADRA2A sub-subfamily
Tissue Specificity
Expressed in brain.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products